BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C06 (862 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24057| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.69 SB_4617| Best HMM Match : Extensin_2 (HMM E-Value=0.38) 29 3.7 >SB_24057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 31.9 bits (69), Expect = 0.69 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 407 DWISIMIFNFKYNLKLXSAKVFLVIN 484 DW+S M+ K N KL +AKVF V++ Sbjct: 94 DWVSSMVVAVKRNAKLTNAKVFTVVD 119 >SB_4617| Best HMM Match : Extensin_2 (HMM E-Value=0.38) Length = 450 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 844 APNTQXPXPXRWRIHXAGKTSHPSPGTXNIK 752 APN P P ++ TS P+PGT N++ Sbjct: 213 APNMMSPSPQQFIAQSPAPTSVPTPGTLNVQ 243 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,474,173 Number of Sequences: 59808 Number of extensions: 377463 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2455286845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -