Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP04_F_C06
         (862 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z97634-12|CAI95599.1|  195|Homo sapiens non-metastatic cells 4, ...    35   0.44 

>Z97634-12|CAI95599.1|  195|Homo sapiens non-metastatic cells 4,
           protein expressed in protein.
          Length = 195

 Score = 34.7 bits (76), Expect = 0.44
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = -2

Query: 291 GPRSPGPL*RCHHGCSCPFFQFS*RSSTWVREQRWSCSKPAPERRRRIGSL 139
           GPR+PGP     HG   P      R  +W RE+     KP   +RR +G +
Sbjct: 16  GPRAPGPSLLVRHGSGLPPSALK-RGPSWTRERTLVAVKPDGVQRRLVGDV 65


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,187,477
Number of Sequences: 237096
Number of extensions: 1896996
Number of successful extensions: 2491
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2433
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2491
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10984231046
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)