BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C05 (907 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 25 1.1 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 23 3.3 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.3 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.3 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 22 5.7 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 22 5.7 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 641 PSXRSPVPTLXXTGYLFRLSPLRETVAPSPXXP 739 PS P P L TG+L P V P P P Sbjct: 155 PSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPP 187 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 23.0 bits (47), Expect = 3.3 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 Query: 280 EVFSALMNRPTRGERRFAYWAL 345 EV ALM+R GERRF++ AL Sbjct: 92 EVHEALMSR---GERRFSHKAL 110 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 3.3 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 Query: 280 EVFSALMNRPTRGERRFAYWAL 345 EV ALM+R GERRF++ AL Sbjct: 252 EVHEALMSR---GERRFSHKAL 270 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 3.3 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 Query: 280 EVFSALMNRPTRGERRFAYWAL 345 EV ALM+R GERRF++ AL Sbjct: 252 EVHEALMSR---GERRFSHKAL 270 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 177 NFTNKAFFSXH 145 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 177 NFTNKAFFSXH 145 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,485 Number of Sequences: 336 Number of extensions: 2414 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25237652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -