BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C04 (873 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical ... 32 0.62 Z49937-6|CAA90185.2| 453|Caenorhabditis elegans Hypothetical pr... 31 1.1 Z81542-10|CAB04419.4| 411|Caenorhabditis elegans Hypothetical p... 30 1.9 Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical pr... 29 4.3 >AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical protein F37B4.7 protein. Length = 424 Score = 31.9 bits (69), Expect = 0.62 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 694 LVXIDWRKGVRRSLSXNDVMSYFMEDVDLNTYMYYLHM 807 L ++W++ + L N+V E VD ++YM YL M Sbjct: 180 LPGVEWKEAYEKKLEDNNVQGNLKEIVDQSSYMDYLRM 217 >Z49937-6|CAA90185.2| 453|Caenorhabditis elegans Hypothetical protein F14F3.3 protein. Length = 453 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +1 Query: 220 ILQPTMFEDIKEIAKEYNIEKSCDKYMNVDVVK-QFMEMYKMGMLPRGETFVHTNELQME 396 I+ PT ++ NIE S D +N+D+ K +F + ++ GM + L + Sbjct: 272 IMGPTDLNAFDKLKTRENIEMSSDAIVNLDIPKVEFSDGFRDGMKAWNRSVQTWLALYVH 331 Query: 397 EAVKVFRV 420 VKV RV Sbjct: 332 SRVKVMRV 339 >Z81542-10|CAB04419.4| 411|Caenorhabditis elegans Hypothetical protein F49A5.7 protein. Length = 411 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +2 Query: 482 STEACSSTLLLPRASTEPTARVS-TCPLLTRSIPTSSLTAMSSVKPL 619 + EA SST LL ST TA +S T ++RSI + TA ++++PL Sbjct: 91 TNEASSSTKLL---STSSTAEISSTTRTVSRSIKPETSTASTTIRPL 134 >Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical protein F08H9.1 protein. Length = 607 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -1 Query: 462 RSPHENIEVLSVVEDSEDFD 403 R+P+ENI++L +DSED D Sbjct: 581 RAPYENIDLLLSTDDSEDID 600 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,120,681 Number of Sequences: 27780 Number of extensions: 332563 Number of successful extensions: 833 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2192413762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -