BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C03 (883 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002198-10|AAF99937.1| 471|Caenorhabditis elegans Hypothetical... 31 1.1 Z81103-7|CAB03211.3| 579|Caenorhabditis elegans Hypothetical pr... 30 2.5 Z81103-5|CAD56592.2| 550|Caenorhabditis elegans Hypothetical pr... 30 2.5 Z81088-12|CAD56587.2| 579|Caenorhabditis elegans Hypothetical p... 30 2.5 Z50756-4|CAA90639.1| 482|Caenorhabditis elegans Hypothetical pr... 29 5.8 Z50741-5|CAA90612.1| 482|Caenorhabditis elegans Hypothetical pr... 29 5.8 >AF002198-10|AAF99937.1| 471|Caenorhabditis elegans Hypothetical protein F35F10.12 protein. Length = 471 Score = 31.1 bits (67), Expect = 1.1 Identities = 27/75 (36%), Positives = 33/75 (44%), Gaps = 3/75 (4%) Frame = +3 Query: 189 DPDPFFAQPT-VGNGYEPIDNRPYIVNPPKDYN--PNGNGYEPIDNGAYYVDRPQGPTLL 359 DP+ +QPT +G G P P V PP Y P +G DNGA P GP Sbjct: 345 DPNLPPSQPTPIGGGVAPAGVAPAGVVPPPGYGFLPMTDG---TDNGAGDTPYPVGPPYP 401 Query: 360 QAYPFPWCSRWEVKN 404 P P+ S E K+ Sbjct: 402 SDVPAPYPSGDEPKD 416 >Z81103-7|CAB03211.3| 579|Caenorhabditis elegans Hypothetical protein M04G12.4a protein. Length = 579 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 210 QPTVGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGP 350 QP VGN Y+P P +PP Y GY P G P P Sbjct: 91 QPLVGNSYDP----PVRFDPPYAYRATATGYMPTVPGLSTNSSPYYP 133 >Z81103-5|CAD56592.2| 550|Caenorhabditis elegans Hypothetical protein M04G12.4b protein. Length = 550 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 210 QPTVGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGP 350 QP VGN Y+P P +PP Y GY P G P P Sbjct: 62 QPLVGNSYDP----PVRFDPPYAYRATATGYMPTVPGLSTNSSPYYP 104 >Z81088-12|CAD56587.2| 579|Caenorhabditis elegans Hypothetical protein M04G12.4a protein. Length = 579 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 210 QPTVGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGP 350 QP VGN Y+P P +PP Y GY P G P P Sbjct: 91 QPLVGNSYDP----PVRFDPPYAYRATATGYMPTVPGLSTNSSPYYP 133 >Z50756-4|CAA90639.1| 482|Caenorhabditis elegans Hypothetical protein T08D10.1 protein. Length = 482 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 268 LPKTTTLMETATNLSTTVHITWTVPKXRPYFKPTPFPGAR 387 +P T E A+ + T++ T PK P +P P PG R Sbjct: 23 IPPTVFRFEKASKIGTSLD---TTPKELPIRRPVPLPGPR 59 >Z50741-5|CAA90612.1| 482|Caenorhabditis elegans Hypothetical protein T08D10.1 protein. Length = 482 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 268 LPKTTTLMETATNLSTTVHITWTVPKXRPYFKPTPFPGAR 387 +P T E A+ + T++ T PK P +P P PG R Sbjct: 23 IPPTVFRFEKASKIGTSLD---TTPKELPIRRPVPLPGPR 59 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,595,625 Number of Sequences: 27780 Number of extensions: 251403 Number of successful extensions: 613 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2223883816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -