BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_C01 (872 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96) 32 0.70 >SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96) Length = 725 Score = 31.9 bits (69), Expect = 0.70 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Frame = +3 Query: 123 ALLXMRXRSSFYA-SWXTXRXXRSPAXFQGXSDTLAIFTTLSLXXXXXXXXXSSGLWXXA 299 AL+ M FY+ + T +PA G ++ TTL+L SSG + A Sbjct: 417 ALVVMGSSLWFYSLTKETRSATYAPAIMSGCGTSIMFVTTLALAAELVDQDRSSGAFVMA 476 Query: 300 XXXFLVKVVTXGXFF 344 FL K+V FF Sbjct: 477 SMSFLSKIVLGTLFF 491 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,628,342 Number of Sequences: 59808 Number of extensions: 192520 Number of successful extensions: 219 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 219 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2503194881 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -