BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B24 (904 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 33 0.32 SB_21071| Best HMM Match : efhand (HMM E-Value=0.48) 28 9.0 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +2 Query: 530 KDVLKITFPLKQKQXEDSKRPVAEPTETXPTNVSREEMEFXT 655 K K P ++++ E+ +RP +PT+ PT + R E T Sbjct: 427 KKTTKPLLPEEEEEEEEEERPTPKPTKAKPTTIKRRPTEIPT 468 >SB_21071| Best HMM Match : efhand (HMM E-Value=0.48) Length = 151 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 497 DVNSEGSWVYEKDVLKITFPLKQKQXEDSK--RPVAEPTE 610 DVN +G VY KD L+ F L K +DSK RP +PT+ Sbjct: 112 DVNGKGRIVY-KDFLR-HFVLAMKPQDDSKLIRPKLQPTK 149 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,289,109 Number of Sequences: 59808 Number of extensions: 384312 Number of successful extensions: 1020 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1019 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2597949818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -