BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B23 (887 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 134 9e-32 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 31 0.94 SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 29 5.0 SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_40531| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 134 bits (324), Expect = 9e-32 Identities = 60/88 (68%), Positives = 75/88 (85%) Frame = +1 Query: 430 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRAIRKKMCEIITRDVTN 609 TLIEA +DVKTTDGY+LR+FCIGFT + +KT YA+HTQ++AIRKKM +IITR+V+ Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMVDIITREVST 61 Query: 610 SELREVVNKLIPDSIAKDIEKACHGIYP 693 ++L+EVVNKLIPDSI KDIEK+C IYP Sbjct: 62 NDLKEVVNKLIPDSIGKDIEKSCQSIYP 89 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = +2 Query: 692 PLRDVCIRXVKVLKXPRFEISKLMELH 772 PL DV IR VKVLK P+F+I KLME+H Sbjct: 89 PLHDVHIRKVKVLKKPKFDIGKLMEMH 115 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 31.5 bits (68), Expect = 0.94 Identities = 26/102 (25%), Positives = 40/102 (39%) Frame = +1 Query: 541 AQHTQVRAIRKKMCEIITRDVTNSELREVVNKLIPDSIAKDIEKACHGIYPSARCLHPXG 720 A T + R I R N++L E + S+ D+++ A + P Sbjct: 3950 APTTGISESRSSSVTSIRRRFENNQLEETYKRTETTSLVMDVQERSRESTTLAIDVSPRA 4009 Query: 721 ESVEXAPFRDLEVDGTSXAKAVXARGXPGNXSEXAXGLXTPR 846 SV +P E D S + + G PG+ A G+ TPR Sbjct: 4010 PSVT-SPRTPRESDSPS-TRTPRSMGYPGHPGPRAYGVTTPR 4049 >SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1974 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +1 Query: 262 VFEVSLADLQADTDAERSFRKFRLIAEYVQ 351 +F + +D+QA+++ FR+F L+ EYV+ Sbjct: 1176 IFNNTFSDVQANSNQIWKFRRFELVMEYVE 1205 >SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 1102 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -1 Query: 449 MLASMRVCHFLTIHLSLSVVRSMPWKLQSTLRPCTYSAINLNLRKDLSA--SVSACR 285 ++ SM +C ++ + +SL R + + +L PC Y ++++L + + S+S CR Sbjct: 948 VVMSMSLCRYVHVVMSLCPCRYVHVVMSMSLCPCRYVVMSMSLCRYIHVVMSMSLCR 1004 >SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 126 IVDPFTRKDWYDVKAPSMFSKRQ 194 +V+P+ KDW D SMFS RQ Sbjct: 98 LVEPWRWKDWEDFTQSSMFSGRQ 120 >SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 323 LRKDLSASVSACRSARETSKTLPFNPSEAIFV 228 LRK L S + RE + L FNP E+ +V Sbjct: 302 LRKQLIDMASVAKDLREIDELLKFNPDESAYV 333 >SB_40531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -1 Query: 215 VDKRGADLPLAEHRRSLDIVPIFASEWVDNLLLNTFFTALRQAFIFPDR 69 VD + + +++ D+ PIF + V LLL T FT L+ + DR Sbjct: 159 VDNQFVPFQTLQTKKAFDVEPIFNGKDVFLLLLWTLFTYLQVISVLNDR 207 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,556,479 Number of Sequences: 59808 Number of extensions: 520558 Number of successful extensions: 1449 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1447 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -