BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B19 (841 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g07390.1 68418.m00846 respiratory burst oxidase protein A (Rb... 30 1.7 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 29 2.9 At1g24220.1 68414.m03054 paired amphipathic helix repeat-contain... 29 2.9 At5g45050.2 68418.m05524 disease resistance protein-related simi... 29 5.1 At5g45050.1 68418.m05523 disease resistance protein-related simi... 29 5.1 At4g04490.1 68417.m00651 protein kinase family protein contains ... 29 5.1 At3g20830.1 68416.m02634 protein kinase family protein contains ... 28 6.7 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 28 6.7 >At5g07390.1 68418.m00846 respiratory burst oxidase protein A (RbohA) / NADPH oxidase identical to respiratory burst oxidase protein A from Arabidopsis thaliana [gi:3242781] Length = 902 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +3 Query: 543 RPPDEHHKNRRSSQRWRNPTGL*RYQAFPPWXAPS 647 RPPDEH NR S+ W R P+ AP+ Sbjct: 667 RPPDEHRLNRADSKHWDYIPDFPRILIDGPYGAPA 701 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 29.5 bits (63), Expect = 2.9 Identities = 18/65 (27%), Positives = 26/65 (40%) Frame = -2 Query: 594 FATSDLSVDFCDARQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLS 415 F S S+D+ YG A P YGS P G+ + YP + + P++ Sbjct: 138 FGFSSYSMDYNYPTSYYNVYGGATAQHPMYGSGPMTGVAAAPAAGFYPYLQFAEGNGPVT 197 Query: 414 ELIPL 400 PL Sbjct: 198 GYAPL 202 >At1g24220.1 68414.m03054 paired amphipathic helix repeat-containing protein weak similarity to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 744 Score = 29.5 bits (63), Expect = 2.9 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = -2 Query: 453 PLILWITVLPPLSELIPLAAAERPXXXXXXXXXXXXXQYANRLSPRVGRFI--NAEKTSH 280 P+ L IT++PP + + A++P + N+L P+ R I AEK +H Sbjct: 264 PVKLKITIIPPKARRTIPSEADKPTHTDELN-------FMNKLPPKRRRTIPSEAEKPTH 316 Query: 279 TSTLNLKHKM 250 T LN +K+ Sbjct: 317 TDELNFMNKL 326 >At5g45050.2 68418.m05524 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1344 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 352 PLPRSLTRCARSFGCGERYQLTQRR 426 P PRS RCA S GC R Q+ + R Sbjct: 1169 PYPRSYYRCASSKGCFARKQVERSR 1193 >At5g45050.1 68418.m05523 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1372 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 352 PLPRSLTRCARSFGCGERYQLTQRR 426 P PRS RCA S GC R Q+ + R Sbjct: 1197 PYPRSYYRCASSKGCFARKQVERSR 1221 >At4g04490.1 68417.m00651 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 658 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +1 Query: 499 GTVKRPRC---WRFSIGSAPLTSITKIDAQVRGGETRQDY--KDTRRFPP 633 GTV RP C W + ++ ++ A R +TRQDY K R F P Sbjct: 230 GTVARPSCYFRWDDYRFAGAFDNLERVPAPPRSPQTRQDYRVKKGRMFQP 279 >At3g20830.1 68416.m02634 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 408 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 343 PIRKPPLPARWPIH*CRKNLPHL 275 P PP P R P H CRKN P + Sbjct: 384 PSSAPPSPLRSPPHVCRKNDPFI 406 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 28.3 bits (60), Expect = 6.7 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Frame = -2 Query: 594 FATSDLSVDFCDARQGG-GAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPL 418 F S S+D+ Q YG A P YGS P G+ + YP + + P+ Sbjct: 138 FGFSSYSMDYNYPTQSYYNVYGGATAQHPMYGSGPMTGVAAAPAAGFYPYLQFAEGNGPV 197 Query: 417 SELIPL 400 + PL Sbjct: 198 TGYAPL 203 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,452,505 Number of Sequences: 28952 Number of extensions: 323353 Number of successful extensions: 756 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1941125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -