BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B17 (885 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81565-5|CAB04583.1| 332|Caenorhabditis elegans Hypothetical pr... 28 7.7 Z70686-10|CAD21656.1| 533|Caenorhabditis elegans Hypothetical p... 28 7.7 Z70683-8|CAD21626.1| 533|Caenorhabditis elegans Hypothetical pr... 28 7.7 Z70267-8|CAA94216.1| 332|Caenorhabditis elegans Hypothetical pr... 28 7.7 >Z81565-5|CAB04583.1| 332|Caenorhabditis elegans Hypothetical protein K04C1.6 protein. Length = 332 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -2 Query: 278 VAVLAGLDVEVLGDFVVLSFIVDLV----NVVEKRQNLLLLFDERSVNRCC 138 + + GL + +LS+IV L+ + + Q LLLLF ++V RCC Sbjct: 248 IIIACGLSFKSESTDEILSWIVILIPFASDALTLTQPLLLLFFSKTVRRCC 298 >Z70686-10|CAD21656.1| 533|Caenorhabditis elegans Hypothetical protein F13B12.6 protein. Length = 533 Score = 28.3 bits (60), Expect = 7.7 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -2 Query: 422 KIFGIIEQLEQRDGFFPHFFV-KDRE-FQILGKESDLVHHHEIF--VGFH 285 +I+G RDG F HF V K +E +Q LG ++ V H E+F V +H Sbjct: 424 RIWGYTVSYASRDGSFKHFLVEKIKEGYQFLG--TNQVVHDELFDLVAYH 471 >Z70683-8|CAD21626.1| 533|Caenorhabditis elegans Hypothetical protein F13B12.6 protein. Length = 533 Score = 28.3 bits (60), Expect = 7.7 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -2 Query: 422 KIFGIIEQLEQRDGFFPHFFV-KDRE-FQILGKESDLVHHHEIF--VGFH 285 +I+G RDG F HF V K +E +Q LG ++ V H E+F V +H Sbjct: 424 RIWGYTVSYASRDGSFKHFLVEKIKEGYQFLG--TNQVVHDELFDLVAYH 471 >Z70267-8|CAA94216.1| 332|Caenorhabditis elegans Hypothetical protein K04C1.6 protein. Length = 332 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = -2 Query: 278 VAVLAGLDVEVLGDFVVLSFIVDLV----NVVEKRQNLLLLFDERSVNRCC 138 + + GL + +LS+IV L+ + + Q LLLLF ++V RCC Sbjct: 248 IIIACGLSFKSESTDEILSWIVILIPFASDALTLTQPLLLLFFSKTVRRCC 298 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,222,628 Number of Sequences: 27780 Number of extensions: 373461 Number of successful extensions: 1113 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2234373834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -