BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B15 (923 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY052138-1|AAK93562.1| 1071|Drosophila melanogaster SD09502p pro... 31 1.7 AE014296-2453|AAF49684.2| 1071|Drosophila melanogaster CG5392-PA... 31 1.7 >AY052138-1|AAK93562.1| 1071|Drosophila melanogaster SD09502p protein. Length = 1071 Score = 31.5 bits (68), Expect = 1.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 79 VXCLCGVPPELNQCHFVPGRIQSHCVSRGSASVGRH 186 + C CG+ L QC +P + +HC G+ S RH Sbjct: 653 IVCSCGLQGRLEQCQPLPSYMHAHCTLPGARSY-RH 687 >AE014296-2453|AAF49684.2| 1071|Drosophila melanogaster CG5392-PA protein. Length = 1071 Score = 31.5 bits (68), Expect = 1.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 79 VXCLCGVPPELNQCHFVPGRIQSHCVSRGSASVGRH 186 + C CG+ L QC +P + +HC G+ S RH Sbjct: 653 IVCSCGLQGRLEQCQPLPSYMHAHCTLPGARSY-RH 687 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,443,842 Number of Sequences: 53049 Number of extensions: 389755 Number of successful extensions: 896 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4546383066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -