BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B15 (923 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 3.0 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 9.0 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.4 bits (48), Expect = 3.0 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +2 Query: 47 VGIDQSSCFL---WXRVCVVYLRN*TSAILCQVGYSPIAFRVGL 169 VGID + ++ W + V +RN I C+ Y I F + L Sbjct: 189 VGIDLTDYYISVEWDIIKVPAVRNEAFYICCEEPYPDIVFNITL 232 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 9.0 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 Query: 131 QVGYSPIAFRVGLHPSAAILVAAG 202 Q SP+ RVG+H A + G Sbjct: 357 QTTNSPVDMRVGIHTGAVLAGVLG 380 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,858 Number of Sequences: 438 Number of extensions: 2676 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30113811 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -