BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= MFBP04_F_B12
(873 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK025577-1|BAB15176.1| 724|Homo sapiens protein ( Homo sapiens ... 33 1.8
>AK025577-1|BAB15176.1| 724|Homo sapiens protein ( Homo sapiens
cDNA: FLJ21924 fis, clone HEP04086. ).
Length = 724
Score = 32.7 bits (71), Expect = 1.8
Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
Frame = -2
Query: 674 HSLXHFKY--FXIQSDIVQYIEVIKHNLFDGFQFIIQNVFVTIFSDFVSFIVVC 519
HSL H+KY + I D V ++K N+F + + VF ++ V ++ VC
Sbjct: 638 HSLHHYKYHVYLICKDEVLSSHLLKKNVFQNVKETLAIVFWSVLKRVVKYMCVC 691
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 97,713,663
Number of Sequences: 237096
Number of extensions: 1717839
Number of successful extensions: 11201
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 7379
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11196
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 11104084400
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -