BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B12 (873 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 30 0.032 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 22 6.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.4 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 8.5 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 29.9 bits (64), Expect = 0.032 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +3 Query: 369 YDDDSTIYVASND-GIYVYKTGDKSFKKYGTFKADVISLTKLNGSDLFYAVTNDNKAY 539 ++ D ++V SN +Y+Y + D S Y FKA+V K D Y V + Y Sbjct: 491 HEYDQNVWVLSNKLAMYLYGSIDSSKINYRIFKANVKEAVKDTXCDPNYVVPDSEHGY 548 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 552 NGNKYVLDDKLKAVKQVMFDNFNVL 626 NGN V D+ +++ + M FNV+ Sbjct: 49 NGNVNVEDENVQSYVECMMKKFNVV 73 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 6.4 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 Query: 108 LIFVVGLSVAASKVLNGSVFRQRSVELYS 194 ++FVVGL A +++ ++Q LYS Sbjct: 27 MVFVVGLERVAEELMGRRRWKQYQDTLYS 55 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.8 bits (44), Expect = 8.5 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 168 RQRSVELYSTEDQVVGAFVISNAEKSEGKI 257 RQR+ + TE++VV A I+ +SE + Sbjct: 56 RQRANDAGLTEEEVVLAKTIAECPESENTV 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,099 Number of Sequences: 438 Number of extensions: 3354 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28280841 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -