BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B11 (876 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 38 0.009 At5g45050.2 68418.m05524 disease resistance protein-related simi... 29 5.4 At5g45050.1 68418.m05523 disease resistance protein-related simi... 29 5.4 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -1 Query: 654 SVSXRVGTGERRGASGGTPVXYSPVGFAPLTERRFCDARPGGASLWKTPATRP 496 SV+ + G RR AS GTP+ YS +GF+P+ G + P P Sbjct: 101 SVNRNLKPGHRRSASAGTPLIYSGLGFSPVNNNNNSSRGGGSGATSPNPGVLP 153 >At5g45050.2 68418.m05524 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1344 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 337 PLPRSLTRCARSFGCGERYQLTQRR 411 P PRS RCA S GC R Q+ + R Sbjct: 1169 PYPRSYYRCASSKGCFARKQVERSR 1193 >At5g45050.1 68418.m05523 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1372 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 337 PLPRSLTRCARSFGCGERYQLTQRR 411 P PRS RCA S GC R Q+ + R Sbjct: 1197 PYPRSYYRCASSKGCFARKQVERSR 1221 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,064,929 Number of Sequences: 28952 Number of extensions: 241809 Number of successful extensions: 589 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2058178400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -