BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B09 (889 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g28550.1 68418.m03483 hypothetical protein 29 5.4 At3g58950.1 68416.m06569 F-box family protein contains F-box dom... 28 9.5 >At5g28550.1 68418.m03483 hypothetical protein Length = 286 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 215 LKXKSLXVEAALRTFGNCLKGLVDLNVLKTEI-EEAKPNGALDEVXKKYCDKSA 373 L+ S+ + +RT C++ L + V K+++ E+ P A+ + + C KSA Sbjct: 152 LEKASMVFKLCIRTVWTCVRLLCQIYVNKSDLSEDCLPKEAIIDFVSEACSKSA 205 >At3g58950.1 68416.m06569 F-box family protein contains F-box domain Pfam:PF00646 Length = 417 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/60 (28%), Positives = 24/60 (40%) Frame = -2 Query: 690 GXSRXQEVISSTFAHXSTRLKLLADSTVGKLCFKFKKHVLRXSVFCWKHSGPLSAMNKAI 511 G +E++ S L L ADS + K K K V + W GP+ M K + Sbjct: 50 GKREREEILLSFMDFVDNVLALQADSPIKKFSLKCKTGVHPRRLDAWARLGPVLPMLKTL 109 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,504,327 Number of Sequences: 28952 Number of extensions: 275719 Number of successful extensions: 625 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -