BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B07 (877 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera... 44 0.007 UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Re... 43 0.012 >UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera|Rep: Cecropin-B precursor - Bombyx mori (Silk moth) Length = 63 Score = 43.6 bits (98), Expect = 0.007 Identities = 20/35 (57%), Positives = 22/35 (62%) Frame = +2 Query: 167 AAPXPXWXLFKXXXXXGXHXRAGIVKAGPAXXVLG 271 AAP P W +FK G + R GIVKAGPA VLG Sbjct: 22 AAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLG 56 >UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Rep: Cecropin-A precursor - Hyalophora cecropia (Cecropia moth) Length = 64 Score = 42.7 bits (96), Expect = 0.012 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = +2 Query: 167 AAPXPXWXLFKXXXXXGXHXRAGIVKAGPAXXVLG 271 AAP P W LFK G + R GI+KAGPA V+G Sbjct: 22 AAPEPKWKLFKKIEKVGQNIRDGIIKAGPAVAVVG 56 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 371,920,851 Number of Sequences: 1657284 Number of extensions: 3781468 Number of successful extensions: 22307 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17500 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 78292544701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -