BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B05 (890 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006730-6|AAX22282.1| 324|Caenorhabditis elegans Serpentine re... 29 5.9 AC006730-5|AAF60478.4| 320|Caenorhabditis elegans Serpentine re... 29 5.9 >AC006730-6|AAX22282.1| 324|Caenorhabditis elegans Serpentine receptor, class i protein40, isoform b protein. Length = 324 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -3 Query: 648 LENQLYCCMEYNFSFHLRDFILIFLVNKVGISIALASICSRIVEV 514 ++N YC + + L DF L FL+ + + +A CS + V Sbjct: 40 IDNFRYCILVFQLLCTLTDFYLTFLMQPIPLFPIIAGYCSGFLAV 84 >AC006730-5|AAF60478.4| 320|Caenorhabditis elegans Serpentine receptor, class i protein40, isoform a protein. Length = 320 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -3 Query: 648 LENQLYCCMEYNFSFHLRDFILIFLVNKVGISIALASICSRIVEV 514 ++N YC + + L DF L FL+ + + +A CS + V Sbjct: 40 IDNFRYCILVFQLLCTLTDFYLTFLMQPIPLFPIIAGYCSGFLAV 84 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,768,747 Number of Sequences: 27780 Number of extensions: 381829 Number of successful extensions: 1085 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2255353870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -