BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B04 (950 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 32 0.029 DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domai... 29 0.16 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 28 0.36 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 28 0.36 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 27 0.83 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 31.9 bits (69), Expect = 0.029 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = +1 Query: 208 CPQMAEPDCXXPEVHXFVDHVGPCXVPQCFCERPNVRNTKTGKCVPESEC 357 C EP C PE D C V CFC++ VR G C+ +C Sbjct: 47 CGPCVEPTCSKPEPD--ADCTNVC-VAGCFCKKNYVRRAIGGSCIWAKKC 93 >DQ370039-1|ABD18600.1| 168|Anopheles gambiae putative TIL domain polypeptide protein. Length = 168 Score = 29.5 bits (63), Expect = 0.16 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 292 CFCERPNVRNTKTGKCVPE 348 CFC+ VR +K GKC+P+ Sbjct: 70 CFCKPGFVRESKEGKCIPK 88 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 28.3 bits (60), Expect = 0.36 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 283 VPQCFCERPNVRNTKTGKCVP 345 +P C C++ VR T+ G CVP Sbjct: 55 LPGCVCKKGFVRETQFGNCVP 75 Score = 28.3 bits (60), Expect = 0.36 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 292 CFCERPNVRNTKTGKCVPESEC 357 C C++ VR T+ GKC+P C Sbjct: 95 CVCKKGFVRKTEFGKCIPLRLC 116 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 28.3 bits (60), Expect = 0.36 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 292 CFCERPNVRNTKTGKCVPESEC 357 CFC+ +R++ G C+P + C Sbjct: 172 CFCKPSYIRSSDGGPCIPTNNC 193 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 27.1 bits (57), Expect = 0.83 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 259 VDHVGPCXVPQCFCERPNVRNTKTGKCVPESEC 357 +D G C +C+C VR G+C+P+ C Sbjct: 77 LDCAGRCYA-ECYCASGFVREYPGGRCIPKLFC 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 331,757 Number of Sequences: 2352 Number of extensions: 4853 Number of successful extensions: 44 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 104189652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -