BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B01 (862 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 52 1e-05 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 52 2e-05 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 51 4e-05 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 50 8e-05 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 49 1e-04 UniRef50_UPI00015B55AC Cluster: PREDICTED: similar to GA10757-PA... 48 3e-04 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 48 3e-04 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 48 4e-04 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 48 4e-04 UniRef50_A4RD40 Cluster: Putative uncharacterized protein; n=2; ... 48 4e-04 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 47 5e-04 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 47 5e-04 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 47 7e-04 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 47 7e-04 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 46 0.001 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 46 0.001 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 46 0.001 UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled ho... 36 0.001 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 46 0.001 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 46 0.001 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 46 0.001 UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Pr... 46 0.001 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 46 0.002 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 46 0.002 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 46 0.002 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 46 0.002 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 46 0.002 UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG057... 42 0.002 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 45 0.002 UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar ... 45 0.002 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 45 0.002 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 45 0.002 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 45 0.002 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 45 0.002 UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Eut... 45 0.002 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 45 0.003 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 45 0.003 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 45 0.003 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 45 0.003 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 45 0.003 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 45 0.003 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 45 0.003 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 45 0.003 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 45 0.003 UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein;... 44 0.004 UniRef50_Q4PSF3 Cluster: Proline-rich extensin-like family prote... 44 0.004 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 44 0.004 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 44 0.004 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 44 0.005 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 44 0.005 UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; ... 44 0.005 UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabido... 44 0.005 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 44 0.005 UniRef50_A4R9P2 Cluster: Predicted protein; n=1; Magnaporthe gri... 44 0.005 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 44 0.005 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 44 0.005 UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein... 44 0.007 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 44 0.007 UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Dia... 44 0.007 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 43 0.009 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 43 0.009 UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere... 43 0.009 UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 43 0.009 UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein;... 43 0.011 UniRef50_A4TTL3 Cluster: Putative uncharacterized protein; n=2; ... 43 0.011 UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-... 43 0.011 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 43 0.011 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 42 0.015 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 42 0.015 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 42 0.015 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 42 0.015 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 42 0.015 UniRef50_Q10AA9 Cluster: La domain containing protein, expressed... 42 0.015 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 42 0.015 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 42 0.015 UniRef50_Q9NSV4 Cluster: Protein diaphanous homolog 3; n=66; Deu... 42 0.015 UniRef50_P22357 Cluster: Anther-specific protein SF18 precursor;... 42 0.015 UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|R... 42 0.020 UniRef50_Q2H982 Cluster: Predicted protein; n=1; Chaetomium glob... 42 0.020 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 42 0.020 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 42 0.020 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 42 0.026 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 42 0.026 UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12;... 42 0.026 UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; ... 42 0.026 UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; ... 42 0.026 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 42 0.026 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 42 0.026 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 42 0.026 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 42 0.026 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 42 0.026 UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella ve... 42 0.026 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 42 0.026 UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L spl... 41 0.035 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 41 0.035 UniRef50_Q2V2M9-2 Cluster: Isoform 2 of Q2V2M9 ; n=9; Amniota|Re... 41 0.035 UniRef50_Q5C3I4 Cluster: SJCHGC03138 protein; n=2; Schistosoma j... 41 0.035 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 41 0.035 UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella ve... 41 0.035 UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; ... 41 0.035 UniRef50_Q6CAY8 Cluster: Similarity; n=2; Fungi/Metazoa group|Re... 41 0.035 UniRef50_A0JLT2 Cluster: Mediator of RNA polymerase II transcrip... 41 0.035 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 41 0.035 UniRef50_Q2V2M9 Cluster: FH1/FH2 domain-containing protein 3; n=... 41 0.035 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 41 0.046 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 41 0.046 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 41 0.046 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 41 0.046 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 41 0.046 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 41 0.046 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 41 0.046 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 41 0.046 UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; ... 41 0.046 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 41 0.046 UniRef50_UPI0000E49E39 Cluster: PREDICTED: similar to Wiskott-Al... 40 0.061 UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 ... 40 0.061 UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, peripla... 40 0.061 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 40 0.061 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 40 0.061 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 40 0.061 UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms... 40 0.061 UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cere... 40 0.061 UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; ... 40 0.061 UniRef50_A6QTR5 Cluster: Adenylyl cyclase-associated protein; n=... 40 0.061 UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2... 40 0.061 UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH30... 40 0.081 UniRef50_Q0S917 Cluster: Possible proline rich protein; n=1; Rho... 40 0.081 UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein;... 40 0.081 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 40 0.081 UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En... 40 0.081 UniRef50_Q6C6N4 Cluster: Similar to DEHA0F03828g Debaryomyces ha... 40 0.081 UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; ... 40 0.081 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 40 0.081 UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - ... 40 0.081 UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n... 40 0.11 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 40 0.11 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 40 0.11 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 40 0.11 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 40 0.11 UniRef50_Q6PSU8 Cluster: Formin homology 2 domain-containing pro... 40 0.11 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 40 0.11 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 40 0.11 UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella ve... 40 0.11 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 40 0.11 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 40 0.11 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 39 0.14 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 39 0.14 UniRef50_UPI0000E464D4 Cluster: PREDICTED: similar to ENSANGP000... 39 0.14 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 39 0.14 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 39 0.14 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 39 0.14 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 39 0.14 UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG214... 39 0.14 UniRef50_Q54TI7 Cluster: WH2 domain-containing protein; n=1; Dic... 39 0.14 UniRef50_Q23248 Cluster: Putative uncharacterized protein grl-21... 39 0.14 UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; ... 39 0.14 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 39 0.14 UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, wh... 39 0.14 UniRef50_A0CJV0 Cluster: Chromosome undetermined scaffold_2, who... 39 0.14 UniRef50_A0CFX0 Cluster: Chromosome undetermined scaffold_177, w... 39 0.14 UniRef50_Q7SFQ1 Cluster: Predicted protein; n=1; Neurospora cras... 39 0.14 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 39 0.14 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 39 0.14 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 39 0.19 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 39 0.19 UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis... 39 0.19 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 39 0.19 UniRef50_A4RU08 Cluster: Predicted protein; n=1; Ostreococcus lu... 39 0.19 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 39 0.19 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 39 0.19 UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cere... 39 0.19 UniRef50_Q0UQG7 Cluster: Adenylyl cyclase-associated protein; n=... 39 0.19 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 39 0.19 UniRef50_P41484 Cluster: Proline-rich antigen; n=21; Mycobacteri... 39 0.19 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 39 0.19 UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Sacc... 39 0.19 UniRef50_UPI0000EB21A1 Cluster: ABI gene family member 3 (New mo... 38 0.25 UniRef50_Q4TB92 Cluster: Chromosome undetermined SCAF7174, whole... 38 0.25 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 38 0.25 UniRef50_Q9L252 Cluster: Putative uncharacterized protein SCO266... 38 0.25 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 38 0.25 UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas ne... 38 0.25 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 38 0.25 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 38 0.25 UniRef50_Q9GYL4 Cluster: Putative uncharacterized protein R04E5.... 38 0.25 UniRef50_Q5TV67 Cluster: ENSANGP00000026333; n=1; Anopheles gamb... 38 0.25 UniRef50_Q23G58 Cluster: Putative uncharacterized protein; n=1; ... 38 0.25 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 38 0.25 UniRef50_A2F9Y4 Cluster: Putative uncharacterized protein; n=1; ... 38 0.25 UniRef50_Q2HGM6 Cluster: Putative uncharacterized protein; n=1; ... 38 0.25 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 38 0.25 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 38 0.25 UniRef50_A5E6V9 Cluster: Putative uncharacterized protein; n=1; ... 38 0.25 UniRef50_Q96T25 Cluster: Zinc finger protein ZIC 5; n=16; Theria... 38 0.25 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 38 0.25 UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, in... 38 0.33 UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endo... 38 0.33 UniRef50_Q6P120 Cluster: Enah/Vasp-like b; n=2; Danio rerio|Rep:... 38 0.33 UniRef50_A0J0A0 Cluster: Putative lipoprotein precursor; n=2; Al... 38 0.33 UniRef50_Q8RVC4 Cluster: P0482D04.1 protein; n=4; Oryza sativa|R... 38 0.33 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 38 0.33 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 38 0.33 UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; D... 38 0.33 UniRef50_Q23137 Cluster: Ground-like (Grd related) protein 22; n... 38 0.33 UniRef50_A2EVR8 Cluster: Putative uncharacterized protein; n=1; ... 38 0.33 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 38 0.33 UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|... 38 0.33 UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic p... 38 0.33 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 38 0.33 UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomyc... 38 0.33 UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family... 38 0.33 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 38 0.33 UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleosto... 38 0.33 UniRef50_P04280 Cluster: Basic salivary proline-rich protein 1 p... 38 0.33 UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5... 38 0.33 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 35 0.41 UniRef50_UPI0000E80618 Cluster: PREDICTED: hypothetical protein;... 38 0.43 UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to... 38 0.43 UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; ... 38 0.43 UniRef50_Q82HS3 Cluster: Putative uncharacterized protein; n=1; ... 38 0.43 UniRef50_Q5YRG4 Cluster: Putative uncharacterized protein; n=1; ... 38 0.43 UniRef50_O86637 Cluster: Putative uncharacterized protein SCO571... 38 0.43 UniRef50_Q1GTX9 Cluster: Putative uncharacterized protein precur... 38 0.43 UniRef50_Q022J1 Cluster: Putative secreted protein precursor; n=... 38 0.43 UniRef50_Q93107 Cluster: Myosin I heavy chain kinase; n=1; Acant... 38 0.43 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 38 0.43 UniRef50_Q7KUL0 Cluster: CG9425-PB, isoform B; n=4; Diptera|Rep:... 38 0.43 UniRef50_Q1XIS2 Cluster: Formactin; n=4; Caenorhabditis|Rep: For... 38 0.43 UniRef50_A2ELJ5 Cluster: Putative uncharacterized protein; n=1; ... 38 0.43 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 38 0.43 UniRef50_Q4WG58 Cluster: Actin cortical patch assembly protein P... 38 0.43 UniRef50_A7LNW5 Cluster: Hydrophobin; n=1; Trichoderma atrovirid... 38 0.43 UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; ... 38 0.43 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 38 0.43 UniRef50_Q69U86 Cluster: Putative uncharacterized protein P0414C... 29 0.47 UniRef50_UPI00015B5C43 Cluster: PREDICTED: similar to homeobox p... 29 0.52 UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous... 37 0.57 UniRef50_UPI0000E45FF5 Cluster: PREDICTED: hypothetical protein;... 37 0.57 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 37 0.57 UniRef50_UPI0000DA1F1A Cluster: PREDICTED: hypothetical protein;... 37 0.57 UniRef50_UPI000023F6A5 Cluster: hypothetical protein FG10389.1; ... 37 0.57 UniRef50_UPI0000F30461 Cluster: Formin-2.; n=2; Bos taurus|Rep: ... 37 0.57 UniRef50_Q4RLP1 Cluster: Chromosome 10 SCAF15019, whole genome s... 37 0.57 UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome s... 37 0.57 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 37 0.57 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 37 0.57 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 37 0.57 UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En... 37 0.57 UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=... 37 0.57 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 37 0.57 UniRef50_Q9U3U1 Cluster: SF1 protein; n=3; Caenorhabditis|Rep: S... 37 0.57 UniRef50_Q8MQE6 Cluster: Wasp (Actin cytoskeleton modulator) hom... 37 0.57 UniRef50_Q7PUD2 Cluster: ENSANGP00000013887; n=2; Culicidae|Rep:... 37 0.57 UniRef50_Q7KW17 Cluster: CG14622-PC, isoform C; n=10; Coelomata|... 37 0.57 UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; ... 37 0.57 UniRef50_Q6BUJ5 Cluster: Similar to sp|P37370 Saccharomyces cere... 37 0.57 UniRef50_Q4WNW8 Cluster: KH domain protein; n=13; Pezizomycotina... 37 0.57 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 37 0.57 UniRef50_Q2H239 Cluster: Putative uncharacterized protein; n=1; ... 37 0.57 UniRef50_Q0TWV8 Cluster: Predicted protein; n=1; Phaeosphaeria n... 37 0.57 UniRef50_Q0CLE5 Cluster: Predicted protein; n=1; Aspergillus ter... 37 0.57 UniRef50_Q8NFJ8 Cluster: Class B basic helix-loop-helix protein ... 37 0.57 UniRef50_O60195 Cluster: CAP; n=1; Lentinula edodes|Rep: CAP - L... 28 0.72 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 37 0.75 UniRef50_UPI0000E4A721 Cluster: PREDICTED: similar to LOC397922 ... 37 0.75 UniRef50_UPI0000F32FE2 Cluster: UPI0000F32FE2 related cluster; n... 37 0.75 UniRef50_Q4TB69 Cluster: Chromosome 11 SCAF7190, whole genome sh... 37 0.75 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 37 0.75 UniRef50_Q828N1 Cluster: Putative secreted protein; n=5; Strepto... 37 0.75 UniRef50_Q743K0 Cluster: Putative uncharacterized protein; n=2; ... 37 0.75 UniRef50_Q6M9P0 Cluster: Putative uncharacterized protein; n=1; ... 37 0.75 UniRef50_Q2JSH7 Cluster: Putative uncharacterized protein; n=2; ... 37 0.75 UniRef50_A7HHG7 Cluster: ATPase (AAA+ superfamily)-like protein;... 37 0.75 UniRef50_A6G312 Cluster: Serine/threonine protein kinase; n=1; P... 37 0.75 UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|R... 37 0.75 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 37 0.75 UniRef50_A4RW22 Cluster: Predicted protein; n=1; Ostreococcus lu... 37 0.75 UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; ... 37 0.75 UniRef50_Q5C113 Cluster: SJCHGC03128 protein; n=4; Eukaryota|Rep... 37 0.75 UniRef50_A1E5L3 Cluster: Serine-peptidase; n=2; Drosophila melan... 37 0.75 UniRef50_Q872W5 Cluster: Putative uncharacterized protein B2G14.... 37 0.75 UniRef50_Q6FIZ5 Cluster: Similarity; n=1; Candida glabrata|Rep: ... 37 0.75 UniRef50_Q5A217 Cluster: Putative uncharacterized protein; n=1; ... 37 0.75 UniRef50_Q0UMH1 Cluster: Putative uncharacterized protein; n=1; ... 37 0.75 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 37 0.75 UniRef50_Q9Y2V3 Cluster: Retinal homeobox protein Rx; n=16; Ther... 37 0.75 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 37 0.75 UniRef50_P04281 Cluster: Basic proline-rich peptide IB-1; n=6; E... 37 0.75 UniRef50_Q5VT52 Cluster: Uncharacterized protein KIAA0460; n=33;... 37 0.75 UniRef50_Q7SC37 Cluster: Predicted protein; n=1; Neurospora cras... 29 0.87 UniRef50_Q68BK1 Cluster: Poly(A) binding protein I; n=1; Nannoch... 28 0.91 UniRef50_UPI00015B57D1 Cluster: PREDICTED: similar to GA11375-PA... 36 1.00 UniRef50_UPI0001554718 Cluster: PREDICTED: similar to NHS-like 1... 36 1.00 UniRef50_UPI0000DB7D01 Cluster: PREDICTED: similar to Wiskott-Al... 36 1.00 UniRef50_UPI000023CED7 Cluster: hypothetical protein FG02794.1; ... 36 1.00 UniRef50_P42859-2 Cluster: Isoform Short of P42859 ; n=7; Deuter... 36 1.00 UniRef50_Q8UZB6 Cluster: Replicase; n=5; Grapevine fleck virus|R... 36 1.00 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 36 1.00 UniRef50_Q6MRL4 Cluster: Putative uncharacterized protein precur... 36 1.00 UniRef50_Q3W1Z4 Cluster: Putative uncharacterized protein; n=1; ... 36 1.00 UniRef50_Q1D1I3 Cluster: Response regulator/GGDEF domain protein... 36 1.00 UniRef50_Q099E7 Cluster: Putative uncharacterized protein; n=1; ... 36 1.00 UniRef50_A4LPA5 Cluster: Intracellular motility protein A; n=6; ... 36 1.00 UniRef50_A3TRM3 Cluster: Putative uncharacterized protein; n=1; ... 36 1.00 UniRef50_A1G4V0 Cluster: Putative uncharacterized protein; n=2; ... 36 1.00 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 36 1.00 UniRef50_Q8L7S5 Cluster: AT4g18560/F28J12_220; n=2; Arabidopsis ... 36 1.00 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 36 1.00 UniRef50_A5AVJ0 Cluster: Putative uncharacterized protein; n=1; ... 36 1.00 UniRef50_A0DM29 Cluster: Chromosome undetermined scaffold_56, wh... 36 1.00 UniRef50_Q0UAV3 Cluster: Putative uncharacterized protein; n=1; ... 36 1.00 UniRef50_Q0U8T6 Cluster: Predicted protein; n=1; Phaeosphaeria n... 36 1.00 UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; ... 36 1.00 UniRef50_A4RP63 Cluster: Putative uncharacterized protein; n=1; ... 36 1.00 UniRef50_A4R6T5 Cluster: Predicted protein; n=1; Magnaporthe gri... 36 1.00 UniRef50_Q0DIP2 Cluster: Os05g0373400 protein; n=7; Oryza sativa... 30 1.2 UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n... 36 1.3 UniRef50_UPI00015B5CAE Cluster: PREDICTED: similar to conserved ... 36 1.3 UniRef50_UPI0000E4931A Cluster: PREDICTED: hypothetical protein;... 36 1.3 UniRef50_UPI000023DFC2 Cluster: hypothetical protein FG08775.1; ... 36 1.3 UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein... 36 1.3 UniRef50_UPI000069F3B2 Cluster: UPI000069F3B2 related cluster; n... 36 1.3 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 36 1.3 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 36 1.3 UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein p... 36 1.3 UniRef50_A1FZ88 Cluster: Outer membrane autotransporter barrel d... 36 1.3 UniRef50_Q9SPP7 Cluster: Fertilin alpha subunit; n=9; Oryza sati... 36 1.3 UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza s... 36 1.3 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 36 1.3 UniRef50_Q2R360 Cluster: C2 domain containing protein, expressed... 36 1.3 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 36 1.3 UniRef50_Q01L28 Cluster: OSIGBa0147J02.2 protein; n=7; Oryza sat... 36 1.3 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 36 1.3 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 36 1.3 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 1.3 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 1.3 UniRef50_Q9VC76 Cluster: CG13615-PA; n=2; Sophophora|Rep: CG1361... 36 1.3 UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|R... 36 1.3 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 36 1.3 UniRef50_A7SL00 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 36 1.3 UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella ve... 36 1.3 UniRef50_A7AVR9 Cluster: Eukaryotic initiation factor 4G middle ... 36 1.3 UniRef50_A2EJF1 Cluster: LIM domain containing protein; n=4; Tri... 36 1.3 UniRef50_A0CRC9 Cluster: Chromosome undetermined scaffold_25, wh... 36 1.3 UniRef50_Q5BDW2 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium glob... 36 1.3 UniRef50_Q0V2M3 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 36 1.3 UniRef50_A7TP17 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_A4RLD7 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Ad... 36 1.3 UniRef50_Q03209 Cluster: 61 kDa protein; n=6; Nucleopolyhedrovir... 36 1.3 UniRef50_P10165 Cluster: Proline-rich proteoglycan 2 precursor; ... 36 1.3 UniRef50_P65379 Cluster: Putative membrane protein mmpS3; n=15; ... 36 1.3 UniRef50_Q75A59 Cluster: Transcriptional regulatory protein LGE1... 36 1.3 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 36 1.3 UniRef50_Q0JF59 Cluster: Os04g0151600 protein; n=1; Oryza sativa... 25 1.4 UniRef50_Q8VKS5 Cluster: Penicillin-binding protein; n=26; Coryn... 28 1.5 UniRef50_A7QDU5 Cluster: Chromosome chr4 scaffold_83, whole geno... 27 1.6 UniRef50_UPI00015B605E Cluster: PREDICTED: similar to vasodilato... 36 1.7 UniRef50_Q4S708 Cluster: Chromosome 14 SCAF14723, whole genome s... 36 1.7 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 36 1.7 UniRef50_Q4RE14 Cluster: Chromosome undetermined SCAF15155, whol... 36 1.7 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 36 1.7 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 36 1.7 UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae... 36 1.7 UniRef50_A1TE68 Cluster: Protein kinase; n=2; Mycobacterium|Rep:... 36 1.7 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 36 1.7 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 36 1.7 UniRef50_Q0JJ15 Cluster: Os01g0765300 protein; n=4; Oryza sativa... 36 1.7 UniRef50_A5BUJ6 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_A4S0Z6 Cluster: Predicted protein; n=2; Ostreococcus|Re... 36 1.7 UniRef50_Q9UA70 Cluster: Unconventional myosin heavy chain MyoK;... 36 1.7 UniRef50_Q5BWN9 Cluster: SJCHGC07001 protein; n=1; Schistosoma j... 36 1.7 UniRef50_Q57WJ7 Cluster: Calpain, putative; n=3; Trypanosoma bru... 36 1.7 UniRef50_Q54CK9 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 36 1.7 UniRef50_Q387Y0 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.7 UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_Q7S8U1 Cluster: Putative uncharacterized protein NCU052... 36 1.7 UniRef50_Q7S7S6 Cluster: Putative uncharacterized protein NCU042... 36 1.7 UniRef50_Q6CEK4 Cluster: Similar to tr|O42854 Schizosaccharomyce... 36 1.7 UniRef50_A3GHT1 Cluster: Predicted protein; n=3; Saccharomycetac... 36 1.7 UniRef50_P33485 Cluster: Probable nuclear antigen; n=5; root|Rep... 36 1.7 UniRef50_P42858 Cluster: Huntingtin; n=29; Eumetazoa|Rep: Huntin... 36 1.7 UniRef50_Q9C5S0 Cluster: Classical arabinogalactan protein 9 pre... 36 1.7 UniRef50_Q8TEK3 Cluster: Histone-lysine N-methyltransferase, H3 ... 33 1.9 UniRef50_Q6P0D5 Cluster: WW domain-binding protein 11; n=7; Eute... 33 2.0 UniRef50_Q6C1M2 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 27 2.1 UniRef50_UPI00015B90F9 Cluster: UPI00015B90F9 related cluster; n... 35 2.3 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 35 2.3 UniRef50_UPI000023E7FD Cluster: hypothetical protein FG06780.1; ... 35 2.3 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 35 2.3 UniRef50_Q4RMY9 Cluster: Chromosome 6 SCAF15017, whole genome sh... 35 2.3 UniRef50_A2RUZ0 Cluster: Zgc:158474 protein; n=4; Euteleostomi|R... 35 2.3 UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emilian... 35 2.3 UniRef50_Q4USI3 Cluster: Serine protease; n=9; Xanthomonadaceae|... 35 2.3 UniRef50_A5UTQ5 Cluster: Putative uncharacterized protein; n=2; ... 35 2.3 UniRef50_A4FPG3 Cluster: PE-PGRS family protein; n=1; Saccharopo... 35 2.3 UniRef50_A0R4D4 Cluster: Putative uncharacterized protein; n=1; ... 35 2.3 UniRef50_A0GMB5 Cluster: SH3, type 3 precursor; n=2; Burkholderi... 35 2.3 UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole gen... 35 2.3 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 35 2.3 UniRef50_A2Y9Z6 Cluster: Putative uncharacterized protein; n=2; ... 35 2.3 UniRef50_Q7PUR9 Cluster: ENSANGP00000008445; n=1; Anopheles gamb... 35 2.3 UniRef50_Q23JZ2 Cluster: Formin Homology 2 Domain containing pro... 35 2.3 UniRef50_A2FFZ7 Cluster: Putative uncharacterized protein; n=1; ... 35 2.3 UniRef50_A2DML2 Cluster: Putative uncharacterized protein; n=1; ... 35 2.3 UniRef50_Q2GSB8 Cluster: Predicted protein; n=1; Chaetomium glob... 35 2.3 UniRef50_A4R3R8 Cluster: Predicted protein; n=1; Magnaporthe gri... 35 2.3 UniRef50_A4R0U8 Cluster: Predicted protein; n=1; Magnaporthe gri... 35 2.3 UniRef50_A4QXV7 Cluster: Predicted protein; n=1; Magnaporthe gri... 35 2.3 UniRef50_Q9UMN6 Cluster: WW domain-binding protein 7; n=16; Euka... 35 2.3 UniRef50_Q9LKA5 Cluster: Uncharacterized mitochondrial protein A... 35 2.3 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 35 2.3 UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pomb... 35 2.3 UniRef50_Q16630 Cluster: Cleavage and polyadenylation specificit... 35 2.3 UniRef50_O60885 Cluster: Bromodomain-containing protein 4; n=70;... 35 2.3 UniRef50_UPI0000F1E2BF Cluster: PREDICTED: hypothetical protein;... 27 2.6 UniRef50_UPI0000DD7FA7 Cluster: PREDICTED: hypothetical protein;... 27 2.7 UniRef50_UPI000155C7CA Cluster: PREDICTED: similar to FLJ42117 p... 35 3.0 UniRef50_UPI0000E81406 Cluster: PREDICTED: hypothetical protein;... 35 3.0 UniRef50_UPI0000E4A1BC Cluster: PREDICTED: similar to myosin XV;... 35 3.0 UniRef50_UPI0000DB7F80 Cluster: PREDICTED: similar to SSXT prote... 35 3.0 UniRef50_UPI0000D9CB54 Cluster: PREDICTED: hypothetical protein;... 35 3.0 UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009;... 35 3.0 UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n... 35 3.0 UniRef50_Q66J90 Cluster: MGC81602 protein; n=3; Xenopus|Rep: MGC... 35 3.0 UniRef50_Q4SS96 Cluster: Chromosome 11 SCAF14479, whole genome s... 35 3.0 UniRef50_Q4SR86 Cluster: Chromosome 11 SCAF14528, whole genome s... 35 3.0 UniRef50_Q684D7 Cluster: Putative uncharacterized protein; n=1; ... 35 3.0 UniRef50_Q3UU70 Cluster: 0 day neonate thymus cDNA, RIKEN full-l... 35 3.0 UniRef50_Q8UA30 Cluster: Putative uncharacterized protein Atu354... 35 3.0 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 35 3.0 UniRef50_Q6N0Q5 Cluster: Putative uncharacterized protein precur... 35 3.0 UniRef50_Q2JGX9 Cluster: Peptidase S1 and S6, chymotrypsin/Hap; ... 35 3.0 UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Ricke... 35 3.0 UniRef50_Q117D5 Cluster: Putative uncharacterized protein precur... 35 3.0 UniRef50_Q0RQI4 Cluster: Putative uncharacterized protein; n=1; ... 35 3.0 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 35 3.0 UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; ce... 35 3.0 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 35 3.0 UniRef50_Q9FF15 Cluster: Arabidopsis thaliana genomic DNA, chrom... 35 3.0 UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; ... 35 3.0 UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassif... 35 3.0 UniRef50_Q0JQG3 Cluster: Os01g0164400 protein; n=3; Oryza sativa... 35 3.0 UniRef50_Q0JNP4 Cluster: Os01g0274800 protein; n=1; Oryza sativa... 35 3.0 UniRef50_O65514 Cluster: Putative glycine-rich cell wall protein... 35 3.0 UniRef50_O64825 Cluster: Putative uncharacterized protein At2g23... 35 3.0 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 35 3.0 UniRef50_A2YML9 Cluster: Putative uncharacterized protein; n=2; ... 35 3.0 UniRef50_Q9VSQ1 Cluster: CG32030-PA, isoform A; n=9; Endopterygo... 35 3.0 UniRef50_Q8IT88 Cluster: UNC-34; n=4; Caenorhabditis|Rep: UNC-34... 35 3.0 UniRef50_Q7PMA5 Cluster: ENSANGP00000031515; n=1; Anopheles gamb... 35 3.0 UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; ... 35 3.0 UniRef50_Q4E4C9 Cluster: Formin, putative; n=1; Trypanosoma cruz... 35 3.0 UniRef50_O01900 Cluster: Putative uncharacterized protein; n=2; ... 35 3.0 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 35 3.0 UniRef50_A4HCC8 Cluster: Putative uncharacterized protein; n=2; ... 35 3.0 UniRef50_A2DXB4 Cluster: Formin Homology 2 Domain containing pro... 35 3.0 UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; ... 35 3.0 UniRef50_Q6CE05 Cluster: Similarity; n=2; Ascomycota|Rep: Simila... 35 3.0 UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; ... 35 3.0 UniRef50_Q0CUB4 Cluster: Predicted protein; n=1; Aspergillus ter... 35 3.0 UniRef50_A6RH13 Cluster: Predicted protein; n=2; Onygenales|Rep:... 35 3.0 UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis... 35 3.0 UniRef50_Q61900 Cluster: Submaxillary gland androgen-regulated p... 35 3.0 UniRef50_Q9ULL5 Cluster: Proline-rich protein 12; n=19; Eutheria... 35 3.0 UniRef50_Q9QYX7 Cluster: Protein piccolo; n=22; cellular organis... 35 3.0 UniRef50_Q9Y6V0 Cluster: Protein piccolo; n=17; Amniota|Rep: Pro... 35 3.0 UniRef50_Q9H461 Cluster: Frizzled-8 precursor; n=10; Theria|Rep:... 35 3.0 UniRef50_Q86T65 Cluster: Disheveled-associated activator of morp... 35 3.0 UniRef50_Q4A2G0 Cluster: Putative membrane protein precursor; n=... 27 3.0 UniRef50_A2QU33 Cluster: Similarity to tumor susceptibility prot... 29 3.4 UniRef50_A6NGB9 Cluster: Uncharacterized protein WIPF3; n=17; Th... 27 3.5 UniRef50_Q020B4 Cluster: Putative uncharacterized protein; n=1; ... 29 3.7 UniRef50_UPI0000E81E09 Cluster: PREDICTED: similar to brain tumo... 29 3.7 UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain... 34 4.0 UniRef50_UPI0000D56E18 Cluster: PREDICTED: hypothetical protein;... 34 4.0 UniRef50_UPI000069EE4E Cluster: WAS/WASL interacting protein fam... 34 4.0 UniRef50_UPI0000F33A0C Cluster: UPI0000F33A0C related cluster; n... 34 4.0 UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n... 34 4.0 UniRef50_UPI0000F30AB8 Cluster: UPI0000F30AB8 related cluster; n... 34 4.0 UniRef50_UPI0000F306C2 Cluster: UPI0000F306C2 related cluster; n... 34 4.0 UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein fam... 34 4.0 UniRef50_Q4T2R8 Cluster: Chromosome undetermined SCAF10201, whol... 34 4.0 UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whol... 34 4.0 UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus tropica... 34 4.0 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 34 4.0 UniRef50_Q287S0 Cluster: ORF1629; n=1; Agrotis segetum nucleopol... 34 4.0 UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; N... 34 4.0 UniRef50_Q98Q42 Cluster: LIPOPROTEIN VSAG; n=3; Mycoplasma pulmo... 34 4.0 UniRef50_Q53WC3 Cluster: Putative uncharacterized protein TTHB03... 34 4.0 UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep... 34 4.0 UniRef50_A6FZI6 Cluster: Type II secretion system protein E; n=1... 34 4.0 UniRef50_A5V8M1 Cluster: OmpA/MotB domain protein precursor; n=3... 34 4.0 UniRef50_A5NR52 Cluster: Putative uncharacterized protein; n=1; ... 34 4.0 UniRef50_A5G0A6 Cluster: OmpA/MotB domain protein precursor; n=1... 34 4.0 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 52.4 bits (120), Expect = 1e-05 Identities = 31/90 (34%), Positives = 33/90 (36%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKF 750 K PPPP GG PPPPPPP PP G A PPP GG Sbjct: 486 KLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPG-KAPPPPPGGKLPPPPPPGGKGAPPP- 543 Query: 751 XXXXXHRXXPXXGRXGGGXXXXXAPPPPXK 840 P G+ G G PPPP + Sbjct: 544 -------PPPPPGKLGPGGGPPPPPPPPPR 566 Score = 40.7 bits (91), Expect = 0.046 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 10/53 (18%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPP-------PQXXXTPPXAXGGXXAX---PPPXG 696 K PPPP GG PPPPPP P PP GG A PPP G Sbjct: 497 KLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPG 549 Score = 40.3 bits (90), Expect = 0.061 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP P PPPPP PP GG PPP Sbjct: 467 PPPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPP 503 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPP + PP G PPP G Sbjct: 467 PPPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPG 507 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPP PP PPP GG Sbjct: 468 PPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGG 508 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPP----PPQXXXTPPXAXGGXXAXPPP 690 K PPPP GG PPPPP P PP G PPP Sbjct: 519 KAPPPPP---GGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGPPPP 560 Score = 34.3 bits (75), Expect = 4.0 Identities = 22/52 (42%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXG--GXXXPPPPPPPQXXXT-PPXAXGGXXAXPP 687 GG GA PPPP G G PPPPPPP+ + A GG A P Sbjct: 536 GGKGA---PPPPPPPPGKLGPGGGPPPPPPPPPRGLGSLGVSALGGPKAPVP 584 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 51.6 bits (118), Expect = 2e-05 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ--XXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPPP PP GG PPP GG Sbjct: 597 PPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPPPGG 639 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ-----XXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPP PP GG PPP GG Sbjct: 584 PPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGG 629 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 GGGG PPPP GG PPPPPP PP GG Sbjct: 604 GGGGP-----PPPPPPPMMGG--GPPPPPPMGGKGGPPPPPGG 639 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGG 341 PPP P G P GG PPP G PPPPP GG Sbjct: 595 PPPPPPPMMGGGGPPPPPPP----PMMGGGPPPPPPMGGKGGPPPPPGGG 640 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 50.8 bits (116), Expect = 4e-05 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP-PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPP P PP GG PPP GG Sbjct: 479 PPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPPIGG 520 Score = 46.8 bits (106), Expect = 7e-04 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP-PQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP P PP GG PPP Sbjct: 456 PPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPPPPP 494 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA-----XGGXXAXPPPXGG 699 PPPP GG PPPPPPP PP GG PP GG Sbjct: 442 PPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGG 487 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP GG PPP Sbjct: 424 PPPPPLPPGVGAPPPPPPP----PPPPLPGGSCIPPPP 457 Score = 42.3 bits (95), Expect = 0.015 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP A PPP Sbjct: 455 PPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPPP 492 Score = 38.3 bits (85), Expect = 0.25 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPP-XGGXPP 332 PPP P P G G PPP F G PPPPP GG PP Sbjct: 439 PPPPPPPPLPGGSCIPPPPP--PPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPP 490 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP---PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P P PP GG P P GG Sbjct: 468 PPPPPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGG 511 Score = 35.9 bits (79), Expect = 1.3 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXX--FFXXGXPPPPPXGGXPP 332 PPP P P G P GG PPP F G PPPP GG PP Sbjct: 466 PPPPPPPPFPGGVPPPPP-------LPGGAPPPPPPPPFPGGGVPPPPFPGGGPP 513 Score = 33.9 bits (74), Expect = 5.3 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGG 341 PPP P P G P F GG PPP F G PPPPP GG Sbjct: 479 PPP---PPLPGGAPPPPPPPPFPG---GGVPPPP--FPGGGPPPPPPIGG 520 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +1 Query: 577 PPPPXXXGGXXXP------PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG P PPPPPP P G A PP Sbjct: 493 PPPPFPGGGVPPPPFPGGGPPPPPPIGGMGVPRLPGPPVASGPP 536 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 50.0 bits (114), Expect = 8e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 G GA PPPP G PPPPPPP PP GG PPP GG Sbjct: 1046 GAGAAPPPPPPPPPPPPGGLGGPPPPPPPP-----PPGGFGGPPPPPPPPGG 1092 Score = 46.4 bits (105), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPPP G PPPPPPP PP GG PPP Sbjct: 1028 GLSGAAPPPPPPPPPPPPGAGAAPPPPPPPP---PPPPGGLGGPPPPPPP 1074 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPPP PP GG PPP Sbjct: 1059 PPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPP 1099 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPP----QXXXTPPXAXGGXXAXPPP 690 G PPPP G PPPPPPP PP GG PPP Sbjct: 1063 GGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPPP 1113 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP PP A PPP Sbjct: 1020 PPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPP 1057 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 577 PPPPXXXGGXX-XPPPP----PPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPP PP PP G PPP G Sbjct: 1074 PPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPPG 1118 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 49.2 bits (112), Expect = 1e-04 Identities = 26/59 (44%), Positives = 26/59 (44%), Gaps = 7/59 (11%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQ-------XXXTPPXAXGGXXAXPPPXGG 699 GGGA PPPP GG PPPPPPP PP GG PPP GG Sbjct: 659 GGGA--PPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGG 715 Score = 48.4 bits (110), Expect = 2e-04 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXX---TPPXAXGGXXAXPPPXGG 699 GGGG PPPP GG PPPPPPP PP GG PPP G Sbjct: 674 GGGGP----PPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPPG 725 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP---PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPP P PP A G PPP G Sbjct: 696 PPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFG 739 Score = 43.6 bits (98), Expect = 0.007 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPP + PP PPP GG Sbjct: 708 PPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPPGG 748 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP GG PPP Sbjct: 651 PPPPPPMTGGGAPPPPPPP-----PPMTGGGGPPPPPP 683 Score = 43.2 bits (97), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G A PP Sbjct: 695 PPPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPP 732 Score = 41.9 bits (94), Expect = 0.020 Identities = 38/118 (32%), Positives = 39/118 (33%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKK 519 PP GG A PP + GGGG PP GGG PPPP Sbjct: 655 PPMTGGGAPPPPPPPPPMT----GGGGPPPPPPPPPMTGGGP-------PPPPPPPPMTG 703 Query: 518 XXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFXXGXPPPPPXG 345 P PP P P P GG PP F G PPPPP G Sbjct: 704 GGPPPPPP--PPGGGPPPPPPPP----------GAKAGGPPPPPPPFGKG-PPPPPGG 748 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP + PP G A PP Sbjct: 721 PPPPGAKAGGPPPPPPPFGKGPPPPPGGFGMKKAAAPP 758 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = -1 Query: 829 GGGPXXXNXPPPXAXXXXXXXXXXXXXXXXXXXVPP--LXGGXXXSPPXGGXGPXPPP 662 GGGP PPP PP GG PP G GP PPP Sbjct: 689 GGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPP 746 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGX---PPPPPXGGXPP 332 PPP P G P GG PPP G PPPPP GG PP Sbjct: 665 PPPPPPPMTGGGGPPPPPPP--PPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPP 718 >UniRef50_UPI00015B55AC Cluster: PREDICTED: similar to GA10757-PA; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to GA10757-PA - Nasonia vitripennis Length = 1350 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPPP PP GG + PPP GG Sbjct: 1190 PPPPPPGSFLPPPPPPPELVGSRPPPLGGGRLSSPPPPGG 1229 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXX-PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 GG + + PPP G PPPPPP PP + PPP GG Sbjct: 1166 GGSSSTNLPPLPPPSYLYGPPGSFPPPPPPGSFLPPPPPPPELVGSRPPPLGG 1218 >UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing protein; n=2; Eukaryota|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1189 Score = 48.0 bits (109), Expect = 3e-04 Identities = 23/50 (46%), Positives = 24/50 (48%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GGA + PPPP GG PPPPPPP PP GG P P G Sbjct: 659 GGAPAAPGLVPPPPPPPGGV--PPPPPPPGGVPPPPPPPGGVPPPPAPPG 706 Score = 41.9 bits (94), Expect = 0.020 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPPPPP PP GG PPP GG Sbjct: 669 PPPPPPPGGVPPPPPPPGGVPPPPPPPGG 697 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 PPPP GG PPPPP PP A G A P Sbjct: 679 PPPPPPPGGVPPPPPPP---GGVPPPPAPPGVPAPP 711 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPPPP PP PPP G Sbjct: 599 PPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPG 638 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 GA PPPP G PPPPPPP PP + PPP G Sbjct: 589 GAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPG 638 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP GG PPP Sbjct: 581 PPPPPPLPGAEAPPPPPPP----PPPSGSGGAPPPPPP 614 Score = 40.7 bits (91), Expect = 0.046 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GGA PPPP GG PPPPPP PP A A P Sbjct: 604 GSGGA----PPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAPGAETGP 649 >UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 757 Score = 47.6 bits (108), Expect = 4e-04 Identities = 40/134 (29%), Positives = 40/134 (29%), Gaps = 2/134 (1%) Frame = +3 Query: 333 GGXPPX--GGGGGXPXXKXXXXGGGXPPXKXXXKKXXXXXKGXPXGXXGXXXGGGKXXXX 506 G PP GGGGG P GGG PP G G G GGG Sbjct: 338 GRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGG 397 Query: 507 XGRXFFFXXXXGGGGGFFXXKKXPPPPXXXXGXXXAXXXXXXXXXXXXXTXXGGGXGPXP 686 G GGGGG PP G GGG G P Sbjct: 398 GGGG--GGGPPGGGGG------GPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGP 449 Query: 687 PXGGXXXXPPXRGG 728 P GG P GG Sbjct: 450 PGGGGGGGGPPGGG 463 Score = 43.2 bits (97), Expect = 0.009 Identities = 21/41 (51%), Positives = 22/41 (53%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 PP GGG + P GG GGGGGGG PP GGGG Sbjct: 364 PPEGGGGSDGAPGRGGGGGGPPGGGGGGG--GPPGGGGGGG 402 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 PP GGG PP GG GGGGGG PP GGGG Sbjct: 384 PPGGGGGGGGPPGGGGGGGGGPPGGGGGG---PPGSGGGGG 421 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWG-GGGGGGXXXPPXXXGGGG 576 GGG PP GG G GGGGGG PP GGGG Sbjct: 419 GGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGG 457 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 PP GGG P GG GGGGGG PP GGGG Sbjct: 394 PPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPP--EGGGG 432 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG PP GG G GGGGG PP GGGG Sbjct: 357 GGGGGGGPPEGGGGSDGAPGRGGGGG--GPPGGGGGGG 392 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 695 PXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGG 579 P GG PP GG GGGGGGG PP GGG Sbjct: 375 PGRGGGGGGPPGGGGGGGGPPGGGGGGG-GGPPGGGGGG 412 Score = 37.9 bits (84), Expect = 0.33 Identities = 40/137 (29%), Positives = 40/137 (29%) Frame = +3 Query: 306 PGEKKKKXXGGXPPXGGGGGXPXXKXXXXGGGXPPXKXXXKKXXXXXKGXPXGXXGXXXG 485 PG GG PP GGGG GGG PP G P G G G Sbjct: 352 PGRGGGGGGGGGPPEGGGGS-DGAPGRGGGGGGPP-------GGGGGGGGPPG-GGGGGG 402 Query: 486 GGKXXXXXGRXFFFXXXXGGGGGFFXXKKXPPPPXXXXGXXXAXXXXXXXXXXXXXTXXG 665 GG G GGGGG PP G A G Sbjct: 403 GGPPGGGGGGPPGSGGGGGGGGG---------PPEGGGGSDGAPGRGGGGGGGGGPPGGG 453 Query: 666 GGXGPXPPXGGXXXXPP 716 GG G P GG P Sbjct: 454 GGGGGPPGGGGDPPGVP 470 Score = 35.9 bits (79), Expect = 1.3 Identities = 32/112 (28%), Positives = 32/112 (28%) Frame = +3 Query: 393 GGGXPPXKXXXKKXXXXXKGXPXGXXGXXXGGGKXXXXXGRXFFFXXXXGGGGGFFXXKK 572 GG PP G G G GGG GR GGGGG Sbjct: 337 GGRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGG------ 390 Query: 573 XPPPPXXXXGXXXAXXXXXXXXXXXXXTXXGGGXGPXPPXGGXXXXPPXRGG 728 PP G GGG GP P GG P RGG Sbjct: 391 GGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGP-PEGGGGSDGAPGRGG 441 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGG---GGGGXXXPPXXXGGGG 576 PP GG PP GG GGG GGGG P GGGG Sbjct: 341 PPASGGGGGGPPGRGGG--GGGGGGPPEGGGGSDGAPGRGGGGG 382 Score = 34.7 bits (76), Expect = 3.0 Identities = 21/44 (47%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGG---GGGGXXXPPXXXGGGG 576 PP GGG PP + GG GGG GGGG P GGGG Sbjct: 405 PPGGGGGG--PPGSGGG--GGGGGGPPEGGGGSDGAPGRGGGGG 444 >UniRef50_A4RD40 Cluster: Putative uncharacterized protein; n=2; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 512 Score = 47.6 bits (108), Expect = 4e-04 Identities = 23/54 (42%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPP--PPQXXXTPPXAXGGXXAXPPPXG 696 G GA + PPPP PPPP PP PP A GG A PPP G Sbjct: 458 GAPGASSTPSAAPPPPPSDAAPPPPPPPSAAPPPPPPGPPGASGGYSAVPPPPG 511 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 47.2 bits (107), Expect = 5e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP A PPP G Sbjct: 533 PPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAG 572 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P G PPPPPP PP G PPP Sbjct: 511 PPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPP 548 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP---PQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP GG PPP Sbjct: 522 PPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPP 562 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP-XAXGGXXAXPPPXGG 699 PPPP GG PPPPPPP PP A P P GG Sbjct: 547 PPPPPPKGGA--PPPPPPPARAPPPPAGTPPPPAAAPAPAGG 586 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP G PPPPP PP GG PPP Sbjct: 512 PAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPP 549 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PP P PP G PPP GG Sbjct: 502 PPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGG 542 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 115 PPPPPPTAPPATPPPPPPNHPPPPPPKS--NDIPPPPP 150 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP---PPPQXXXTPPXA 660 PPPP PPPP PPP TPP A Sbjct: 135 PPPPPPKSNDIPPPPPAAIPPPAPPATPPAA 165 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPP 332 PPP P P P G PPP PPPPP GG PP Sbjct: 502 PPPPSAPGVPPAPPLPGA---------GVPPPPPPPGAGAPPPPPPPAGGAPP 545 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 47.2 bits (107), Expect = 5e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPPXGG 699 Q+ PPPP GG PPPPPPP PP G PPP G Sbjct: 355 QQAPPPPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPG 401 Score = 43.2 bits (97), Expect = 0.009 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-----QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP Q PP GG PPP Sbjct: 332 PPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPP 374 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG--XXAXPPPXG 696 PPPP G PPPPPP PP GG PPP G Sbjct: 372 PPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPPPG 413 Score = 41.9 bits (94), Expect = 0.020 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPPXGG 699 + PPPP G PPPPPPP + PP G PPP G Sbjct: 369 RPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPPPG 413 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPP----PQXXXTPPXAXGGXXAXPPPXGG 699 Q PPPP G PPPPPP + PP G PPP G Sbjct: 342 QNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPPPPPG 390 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP G PPP Sbjct: 315 PPPPPLPNSQAPPPPPPPP----PPPPIPGQQNPPPPP 348 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--------QXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP G A PPP Sbjct: 316 PPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPP 361 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP A PPP Sbjct: 297 PPLPNSTSNVTAPPPPPPP-----PPPPLPNSQAPPPP 329 >UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 377 Score = 46.8 bits (106), Expect = 7e-04 Identities = 38/122 (31%), Positives = 39/122 (31%) Frame = +1 Query: 334 GGXPPXGGGGGXPXKKXXXXGGXPPXKKXXXKXLXXXKKGXXGXXGXXKXGGXKXXXXXG 513 G PP GG P GG PP G G GG G Sbjct: 7 GNNPPPPDGGYPPPPPPD--GGYPPPPPPDG----GYPPAQPGGFGPPPQGGYPPPPPPG 60 Query: 514 XXFFFXXXXGGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPX 693 + GG PPPP GG PPPPPP PP GG A PP Sbjct: 61 G---YPPPPQGGFPPPPPGGYPPPPPPQGGSY-PPPPPPGAAGYPPPGYPGGPGAGYPPA 116 Query: 694 GG 699 GG Sbjct: 117 GG 118 Score = 33.9 bits (74), Expect = 5.3 Identities = 23/72 (31%), Positives = 25/72 (34%) Frame = -1 Query: 511 PXXXXFXPPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPP 332 P + PPP P P + GG PP G PPPPP GG PP Sbjct: 12 PPDGGYPPPPPPDGGYPPPPP---PDGGYPPAQPGGFGPPPQG----GYPPPPPPGGYPP 64 Query: 331 XXFFFFSPGXXG 296 F P G Sbjct: 65 PPQGGFPPPPPG 76 Score = 33.9 bits (74), Expect = 5.3 Identities = 23/73 (31%), Positives = 26/73 (35%), Gaps = 3/73 (4%) Frame = -1 Query: 496 FXPPPXXX---PXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPPXX 326 F PPP P P G P + F G PPP PPPP G PP Sbjct: 45 FGPPPQGGYPPPPPPGGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPPPG 104 Query: 325 FFFFSPGXXGVXF 287 + PG G + Sbjct: 105 Y----PGGPGAGY 113 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 46.8 bits (106), Expect = 7e-04 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP GG PPP GG Sbjct: 443 PPPPPPPGMGGGPPPPPPP-----PPGPGGGPPPPPPPPGG 478 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPPP PP GG PPP Sbjct: 445 PPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPPP 485 Score = 43.6 bits (98), Expect = 0.007 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP------PQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP P PP GG PPP Sbjct: 417 PPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPP 460 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP G PPPPPP PP PP Sbjct: 456 PPPPPPPPGPGGGPPPPPPPPGGGPPGPPPPPAQLPP 492 Score = 34.3 bits (75), Expect = 4.0 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = -1 Query: 511 PXXXXFXPPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGX---PPPPPXGG 341 P PPP P G P GG PPP G PPPPP GG Sbjct: 421 PPPGGVPPPPPPPPPGMGGAPPPPPPP--PPGMGGGPPPPPPPPPGPGGGPPPPPPPPGG 478 Query: 340 XPP 332 PP Sbjct: 479 GPP 481 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 + PPPP GG PPPPPP PP G PPP GG Sbjct: 255 RAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG--PGAPPPPGG 295 Score = 43.2 bits (97), Expect = 0.009 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXX-PPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 F + PPPP G PPPPP P PP A G PPP G Sbjct: 153 FNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPG 200 Score = 43.2 bits (97), Expect = 0.009 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP P A G PPP GG Sbjct: 180 PPPPPPPGARPGPPPPPPP------PGARPGPPPPPPPPGG 214 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPP P + PP G A PPP G Sbjct: 245 PPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPPPRG 286 Score = 41.1 bits (92), Expect = 0.035 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPPP 690 PPPP PPPPPPP PP A GG PPP Sbjct: 232 PPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPP 272 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXP--PPXGG 699 PPPP PPPPPPP PP GG + P PP GG Sbjct: 181 PPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGG 226 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GA PPPP G PPPPP + P GG + PPP Sbjct: 187 GARPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPP 233 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXX----TPPXAXGGXXAXPPP 690 PP P G PPPPPPP PP G A PPP Sbjct: 219 PPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPP 260 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PP PPPP T P PPP Sbjct: 31 PPPPRSGVGGNTPPAPPPPPLRSTVPAISPPPPPPPPP 68 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPP---PQXXXTPPXAXGGXXAXPPP 690 AF S PPPP PPPPPP PP A PPP Sbjct: 97 AFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPP 145 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP--PXAXGGXXAXPPP 690 PPP G PPPPPPP P P + A PPP Sbjct: 66 PPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPP 105 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F + PPPP PPPPPP PP PPP Sbjct: 139 FNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPP 183 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 8/46 (17%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP--------PQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP P PP G PPP Sbjct: 130 PPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPP 175 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQ---XXXTPPXAXGGXXAXPPPXGG 699 PPP PPPPP + PP GG PPP G Sbjct: 222 PPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPG 264 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S PPPP PPPPPP PP PPP Sbjct: 124 SHSNAPPPPPLPAARFNAPPPPPP-----PPTTHFNAPPPPPP 161 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXA---XPPP 690 PPPP P PPPPP PP + A PPP Sbjct: 64 PPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPP 104 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ-----XXXTPPXAXGGXXAXPPPXGG 699 P PP GG PPPPPPP PP + GG PPP GG Sbjct: 553 PAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPPGG 598 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + GG PPP Sbjct: 550 PPPPAPPVSGGGPPPPPP----PPPPSSGGGPPPPPPP 583 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP PPPPP PP + GG PPP Sbjct: 532 PPIEAPSSPSLGAPPPPPPPPPAPPVSGGGPPPPPPP 568 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 PPPP GG PPPPPPP P A Sbjct: 580 PPPPPSSGG---PPPPPPPPGGMKKPGA 604 >UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1074 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GGGA PPPP GG PPPPPPP PP G PPP Sbjct: 565 GGGA-PPPSPSPPPPISGGGAPPPPPPPPP-----PPSGGGAPPPPPPP 607 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 GGGA PPPP GG PPPPPPP A G P Sbjct: 581 GGGA--PPPPPPPPPPPSGGGAPPPPPPPPPSGGKKAGAPGAPPTGP 625 >UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled homolog (Drosophila); n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Enabled homolog (Drosophila) - Strongylocentrotus purpuratus Length = 439 Score = 35.5 bits (78), Expect(2) = 0.001 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 698 PPXGGGXAXXPPX-AXGGVXXXWGGGGGGG 612 PP GGG PP A GG GGGGGGG Sbjct: 243 PPAGGGPPPPPPPPAIGGPSASSGGGGGGG 272 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PP P GG PPPPPPP P + GG Sbjct: 240 PPAPPAGGG---PPPPPPPPAIGGPSASSGG 267 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 P PP G PPPPPPP + GG Sbjct: 238 PAPPAPPAGGGPPPPPPPPAIGGPSASSGGG 268 Score = 29.9 bits (64), Expect(2) = 0.001 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 632 GGGGGGGXXXPPXXXGGGGXFF 567 G GGGG PP GGGG F Sbjct: 301 GSSGGGGSNRPPPAGGGGGGDF 322 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP G PPP G Sbjct: 641 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPG 681 Score = 42.3 bits (95), Expect = 0.015 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G PPP Sbjct: 605 PPPPPPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPP 643 Score = 41.1 bits (92), Expect = 0.035 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G PPP Sbjct: 617 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPP 655 Score = 41.1 bits (92), Expect = 0.035 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G PPP Sbjct: 629 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPP 667 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPP PP PPP G Sbjct: 653 PPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPG 692 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP------PPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPP PPPP PP G PPP GG Sbjct: 677 PPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGG 723 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP--PPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPP P PP G PPP G Sbjct: 619 PPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPG 660 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPPP PP G PPP G Sbjct: 653 PPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPG 692 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPP PP G PPP G Sbjct: 631 PPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPG 671 Score = 38.3 bits (85), Expect = 0.25 Identities = 33/120 (27%), Positives = 34/120 (28%), Gaps = 2/120 (1%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXG--GVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXK 525 PP G PP G G+ G G PP G G PPPP Sbjct: 609 PPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGM----PPPPPPPGMPGM 664 Query: 524 KKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFXXGXPPPPPXG 345 P PP P P P G PP G PPPPP G Sbjct: 665 PPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPGMP-GMPPPPPGG 723 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP--PPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPP P PP G PPP G Sbjct: 607 PPPPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPG 648 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 7/48 (14%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-------PPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PP PPPPP PP G PPP G Sbjct: 655 PPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPG 702 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP G PPP G Sbjct: 628 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPG 667 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP P G PPP G Sbjct: 598 PPPPPPPGASSVPPPPPPPGMPGMP--GMPGMPPPPPPPG 635 Score = 37.5 bits (83), Expect = 0.43 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +1 Query: 550 GAFXSQKKXPPP--PXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPPXGG 699 GA PPP P G PPPPPPP PP G PPP G Sbjct: 605 GASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPG 657 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ-XXXTPPXAXGGXXAXPPPXGG 699 PPPP G P PPPP PP G PPP GG Sbjct: 693 PPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGG 734 Score = 36.7 bits (81), Expect = 0.75 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKFXXX 759 PPP G PPPPPP P G PPP G Sbjct: 628 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPG 687 Query: 760 XXHRXXPXXGRXGGGXXXXXAPPPP 834 P G G PPPP Sbjct: 688 MPGMPPPPPGMPGMPGMPGMPPPPP 712 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 8/48 (16%) Frame = +1 Query: 577 PPPPXXXGGXXXPP--------PPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PP PPPPP PP G PPP G Sbjct: 630 PPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPG 677 Score = 35.9 bits (79), Expect = 1.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPP 654 PPP G PPPPPPP PP Sbjct: 587 PPPPPPGASSIPPPPPPPGASSVPP 611 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 8/48 (16%) Frame = +1 Query: 577 PPPPXXXGGXXXPP--------PPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PP PPPPP PP G PPP G Sbjct: 640 PPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPG 687 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPPP PP G P G Sbjct: 587 PPPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPG 626 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG PPPP GG PPPPPPP PP G PPP Sbjct: 816 GGSKTLPRPPPPPPPPPPPGGKSAPPPPPPP----PPPGGKGAPPPPPPP 861 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G P PPPPP PP GG A PPP Sbjct: 810 PPPPPPGGSKTLPRPPPPP----PPPPPPGGKSAPPPP 843 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 9/61 (14%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPP---------XAXGGXXAXPPPXG 696 GG + PPPP G PPPPPPP PP G PPP G Sbjct: 835 GGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPG 894 Query: 697 G 699 G Sbjct: 895 G 895 Score = 39.5 bits (88), Expect = 0.11 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 5/58 (8%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGG--XXAXPPPXGG 699 GG GA PPP G PPPPPP + PP GG PPP GG Sbjct: 850 GGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGG 907 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPP---PXGG 699 PPPP PPPPPPP PP GG PP P GG Sbjct: 875 PPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPPLPPGPRPPGG 920 Score = 35.1 bits (77), Expect = 2.3 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = -3 Query: 602 PPXXXGGGGXFFXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFX 423 PP GG PPPP K P PP P P Sbjct: 810 PPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTG 869 Query: 422 XXFXXGGXPPXXXXFXXGXPPPPPXGGXPP 333 PP PPPPP G PP Sbjct: 870 PPPPPPPPPPGAKTGSAPPPPPPPGGPRPP 899 >UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Protein enabled - Drosophila melanogaster (Fruit fly) Length = 829 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP GG P PP PP PP A GG A PPP Sbjct: 582 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 618 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPPP 690 GG G + PPPP G PPPP P PP A GG PP Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPP 596 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPPXGGXPP 332 GG PPP G PPPP GG PP Sbjct: 567 GGPPPPAPPQMFNGAPPPPAMGGGPP 592 Score = 33.5 bits (73), Expect = 7.0 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -2 Query: 834 GGGGGPXXXTPPPPXPXXXXGAVGGRGXKFFLLXXXXXXXXXXPXPPXXGGXGPXPPP 661 GG GGP PPPP P A GG P PP GG P PP Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPP-----PAPPQMFNGAPPPPAMGGGPPPAPP 596 >UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1140 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP PPP G Sbjct: 557 PPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPPG 596 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPP P PP PPP G Sbjct: 545 PPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPG 584 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT----PPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPPP PP GG PPP GG Sbjct: 1100 PPPPPMRGGA--PPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGG 1142 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ---XXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP PP GG PPP Sbjct: 1039 PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPP 1079 Score = 41.9 bits (94), Expect = 0.020 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPP----PQXXXTPPXAXGGXXAXPPP 690 ++ S PPPP G PPPPPP P PP + G PPP Sbjct: 952 SYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPP 1001 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP-----PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPP P PP G PPP G Sbjct: 1026 PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFG 1071 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPP----PQXXXTPPXAXGGXXAXPPP 690 ++ S PPPP G PPPPPP P PP G PPP Sbjct: 939 SYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPP 988 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP----PQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP PP GG PPP Sbjct: 1013 PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPP 1054 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG----GXXAXPPPXGG 699 PPPP GG PPPPP PP G G PPP GG Sbjct: 1112 PPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGG 1156 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT--PPXAXGGXXAXPPPXGG 699 PPPP GG PPPPP + PP GG PPP G Sbjct: 1124 PPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPG 1166 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT----PPXAXGGXXAXPPP 690 PPPP GG PPPPPPP PP GG PPP Sbjct: 1052 PPPPPMHGGA--PPPPPPPMFGGAQPPPPPPMRGGAPPPPPP 1091 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT----PPXAXGGXXAXPPP 690 PPPP GG PPPPPPP PP GG PPP Sbjct: 1088 PPPPPMRGGA--PPPPPPPMRGGAPPPPPPPMHGGAPPPPPP 1127 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXT-----PPXAXGGXXAXPPP 690 ++ S PPPP PPPPPPP PP GG PPP Sbjct: 991 SYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPP 1041 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP----PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP Q PP G PPP G Sbjct: 1051 PPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRG 1095 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ---XXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP + PP GG PPP Sbjct: 1075 PPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPP 1115 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPP----PQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPPP P PP + G PPP G Sbjct: 935 PPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPG 978 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ---XXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP + PP GG PPP Sbjct: 1063 PPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPP 1103 Score = 36.3 bits (80), Expect = 1.00 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPP-------PPQXXXTPPXAXGGXXAXPPP 690 + S PPPP G PPPPP PP PP GG PPP Sbjct: 979 YGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPP--PPPPPPMHGGAPPPPPP 1028 Score = 35.5 bits (78), Expect = 1.7 Identities = 32/122 (26%), Positives = 32/122 (26%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKK 519 P GG PP GG GG PP GG PPPP Sbjct: 1056 PMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGA----PPPPPPPMRGGAPP 1111 Query: 518 XXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFXXGXPPPPPXGGX 339 P PP P P G PP PPPP G Sbjct: 1112 PPPPPMHGGAPPPPPPPMRGGAPPPPPPP---GGRGPGAPPPPPPPGGRAPGPPPPPGPR 1168 Query: 338 PP 333 PP Sbjct: 1169 PP 1170 Score = 34.3 bits (75), Expect = 4.0 Identities = 34/119 (28%), Positives = 35/119 (29%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKK 519 P GG PP GG GG PP GG APPPP + Sbjct: 1080 PMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGG-------APPPPPPPMRGG 1132 Query: 518 XXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFXXGXPPPPPXGG 342 P PP P P P G PP G PPPPP G Sbjct: 1133 APPPPP----PPGGRGPGAPPPPPPPGGR------APGPPPPPGPRPPGGGPPPPPMLG 1181 Score = 33.9 bits (74), Expect = 5.3 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 10/63 (15%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXX-------FXGGXPPPXXXFFXXGXPPPPP---XGG 341 PPP P G P F GG PPP G PPPPP GG Sbjct: 1049 PPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGG 1108 Query: 340 XPP 332 PP Sbjct: 1109 APP 1111 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPP---XGGXPP 332 GG PPP G PPPPP GG PP Sbjct: 1095 GGAPPPPPPPMRGGAPPPPPPPMHGGAPP 1123 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPP---XGGXPP 332 GG PPP G PPPPP GG PP Sbjct: 1107 GGAPPPPPPPMHGGAPPPPPPPMRGGAPP 1135 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXG-GXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GG PPPP G PP P PP PP G A P G Sbjct: 1141 GGRGPGAPPPPPPPGGRAPGPPPPPGPRPPGGGPPPPPMLGARGAAVDPRG 1191 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +1 Query: 550 GAFXSQKKXPP-PPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G F + K+ PP PP G PPPPPPP PP PPP Sbjct: 1524 GGFGNGKRTPPHPPPSSGSSAPPPPPPPPPPPPPPPPPPPSPPPSPPP 1571 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 G F + PP P G PPPPPPP PP + P G Sbjct: 1159 GPFGQRPPSPPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPPPSYTSPSNG 1208 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPP---PPPQXXXTPPXAXGGXXAXPPP 690 G F + PP P G PPPP PPP PP + PPP Sbjct: 1399 GPFGQRPPSPPHPPPSSGSSAPPPPPHSPPPPPPPPPPSSPPSPPPSPPP 1448 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP G + PP G Sbjct: 561 PPPPPPPPGAGAPPPPPPPGPGLAPPPPKAGGSSSPPAGG 600 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/54 (37%), Positives = 22/54 (40%), Gaps = 5/54 (9%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPPXGG 699 A + + PPPP G PPPP PPP PP G PPP G Sbjct: 529 ALVNAGEAPPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGPG 582 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPP PPP PP G A PPP G Sbjct: 548 PPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGPGLAPPPPKAG 591 >UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein; n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 505 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/90 (27%), Positives = 29/90 (32%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQK 744 +++ PPPP G PPPPPP PP A G PPP R Sbjct: 273 RRQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSV 332 Query: 745 KFXXXXXHRXXPXXGRXGGGXXXXXAPPPP 834 +R P PPPP Sbjct: 333 AVPPPPPNRMYPPPPPALPSSAPSGPPPPP 362 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPPP P A PPP G Sbjct: 345 PPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPG 384 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 577 PPPPXXXG-GXXXPPPPPPPQXXXTPPXAXG 666 PPPP G G PPPPPPP PP G Sbjct: 360 PPPPSVLGVGPVAPPPPPPPPPPPGPPPPPG 390 >UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG05727; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG05727 - Caenorhabditis briggsae Length = 288 Score = 41.5 bits (93), Expect = 0.026 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + ++ PPPP PPPPPPP GG PPP Sbjct: 110 ASRRPPPPPPPPKATGSPPPPPPPPSDEPQEVVAGGASRRPPP 152 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S++ PPPP PPPPPPP A G PPP Sbjct: 111 SRRPPPPPPPPKATGSPPPPPPPPSDEPQEVVAGGASRRPPPP 153 Score = 36.7 bits (81), Expect(2) = 0.002 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 G S++ PPPP G PPPPPPP Sbjct: 24 GGPVSKRPPPPPPPPKGTGSPPPPPPPP 51 Score = 36.7 bits (81), Expect = 0.75 Identities = 23/103 (22%), Positives = 28/103 (27%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXX 726 G A PPPP G PPPPP + PPP G Sbjct: 108 GNASRRPPPPPPPPKATGSPPPPPPPPSDEPQEVVAGGASRRPPPPPPRGTGTPPPPPTG 167 Query: 727 XXRQQKKFXXXXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXR 855 + + P G G PPP + + R Sbjct: 168 VPEELNEANHASRRPPPPPPPPKGTGGPPPPPPPPSDEPQEHR 210 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPP 630 GG + PPPP G PPPPPP Sbjct: 24 GGPVSKRPPPPPPPPKGTGSPPPPPPPP 51 Score = 27.9 bits (59), Expect(2) = 0.002 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +1 Query: 613 PPPPPPPQXXXTP 651 PPPPPPP+ TP Sbjct: 82 PPPPPPPRGTGTP 94 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPPPP PP G A PPP G Sbjct: 93 PPPPPPAGGM--PPPPPPPMGGGAPPPPP-GPGAPPPPPG 129 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 A S K PPPP PPPPP PP GG PPP G Sbjct: 74 AATSSKPAPPPPPPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPPGPG 122 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPPXGGXPP 332 GG PPP G PPPPP G PP Sbjct: 100 GGMPPPPPPPMGGGAPPPPPGPGAPP 125 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 PPPP G PPPPP P PP A Sbjct: 103 PPPPPPPMGGGAPPPPPGPGAPPPPPGA 130 >UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar to human diaphanous homolog 1 (Drosophila) (DIAPH1),; n=4; Eutheria|Rep: Testis cDNA clone: QtsA-11950, similar to human diaphanous homolog 1 (Drosophila) (DIAPH1), - Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) Length = 504 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPP P PP G PPP G Sbjct: 3 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFG 42 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPP PP G A P G Sbjct: 15 PPPPPFPGGPGIPPPPPGMGMPPPPPFGFGASAAPVLPFG 54 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 406 GXPPPXXXFFXXGXPPPPPXGGXPPXXFFFF 314 G PPP G PPPPP G PP F F Sbjct: 13 GIPPPPPFPGGPGIPPPPPGMGMPPPPPFGF 43 >UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 461 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP A GG PPP Sbjct: 294 PPPPPGAPGGGAPPPPPPP-----PPAAAGGAGVPPPP 326 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 GGGA PPPP GG PPPPPPP Sbjct: 302 GGGA--PPPPPPPPPAAAGGAGVPPPPPPP 329 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT----PPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP GG PPP G Sbjct: 679 PPPPSRNGAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPPPPPLG 722 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP + G PPP Sbjct: 644 PPPPPPLPNTQVPPPPPPP--PPPPPPSKNGAPPPPPP 679 Score = 39.5 bits (88), Expect = 0.11 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP G PPPPPPP PP Sbjct: 664 PPPPPSKNGAPPPPPPPPPSRNGAPP 689 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP G PPP Sbjct: 643 PPPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPP 680 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP------PPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP PP PP + G PPP Sbjct: 665 PPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPP 708 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + G PPP Sbjct: 661 PPPPPPPPSKNGAPPPPPP-----PPPSRNGAPPPPPP 693 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP G PPP Sbjct: 663 PPPPPPSKNGAPPPPPPP------PPSRNGAPPPPPPP 694 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G PPP Sbjct: 587 PPPPPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPPP 624 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP PP GG PPP Sbjct: 553 PPPPPPPGGLLTAPPPPPP---PPPPPPPGGSLTAPPP 587 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/50 (40%), Positives = 22/50 (44%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GG+ + PPPP G PPPPPP PP A PPP G Sbjct: 579 GGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPPPMP---GRAPPPPPG 625 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXX---PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPPP PP PPP Sbjct: 572 PPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPP 612 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP PP GG PPP Sbjct: 571 PPPPPPPPGGSLTAPPPPP-----PPPPPGGRLPPPPP 603 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 P PP PPPPPPP T P PPP G Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGG 580 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 + PPPP G PPPP P + PP A Sbjct: 597 RLPPPPPPPPGGMPPPPPMPGRAPPPPPGA 626 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP A PPP G Sbjct: 127 PPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPG 167 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP PPPPPPP PP G PPP G Sbjct: 139 PPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAG 178 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPPPP PP PPP G Sbjct: 139 PPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAG 178 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP A PPP Sbjct: 133 PGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPP 170 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP PPPPP PQ PP G PPP G Sbjct: 188 PPPHPPPAEPAPPPPPAPQGPPAPPPVEG----PPPPKG 222 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXX----AXPPPXGG 699 PPPP PPPPPPP PP A PPP G Sbjct: 140 PPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAG 184 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PP--PPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PP PP G PP PPP + PP A G A PP G Sbjct: 175 PPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEG 216 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPP PPPP+ PP + G PPP G Sbjct: 199 PPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPG----PPPAEG 238 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPP P PP A A PP Sbjct: 150 PPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPP 186 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXP-PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G P PPPP P PP G P P Sbjct: 154 PPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHP 192 >UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Euteleostomi|Rep: Protein diaphanous homolog 1 - Homo sapiens (Human) Length = 1248 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPP P PP G PPP G Sbjct: 694 PPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFG 733 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP PP G + PPP G Sbjct: 588 PPPPAP--GDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSG 626 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPP----PQXXXTPPXAXGGXXAXPPP 690 S + PPPP G PPPPPP PP GG PPP Sbjct: 663 SARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPP 709 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP----PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP P PP G PPP G Sbjct: 681 PPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMG 725 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP---PQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G PPP Sbjct: 655 PPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPP 695 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPP PP G A P G Sbjct: 706 PPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFG 745 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAX--GGXXAXPPP 690 PPP G PPPPP P+ P + GG PPP Sbjct: 620 PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPP 658 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P P + G A PPP Sbjct: 620 PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPP 657 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 P P GG PPPPP P + PP G PPP Sbjct: 643 PSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPP 683 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 406 GXPPPXXXFFXXGXPPPPPXGGXPPXXFFFF 314 G PPP G PPPPP G PP F F Sbjct: 704 GIPPPPPFPGGPGIPPPPPGMGMPPPPPFGF 734 >UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein cappuccino; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Protein cappuccino - Tribolium castaneum Length = 1011 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP GG PPP GG Sbjct: 505 PPPPPMPGIGGPPPPPMPGTGPPPPPPPMGGVPPPPPPMGG 545 Score = 43.6 bits (98), Expect = 0.007 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPPP PP GG PPP G Sbjct: 516 PPPPPMPGTGPPPPPPPMGGVPPPPPPMGGPVPLPPPPAG 555 Score = 43.2 bits (97), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G A PPP Sbjct: 460 PPPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPP 497 Score = 41.9 bits (94), Expect = 0.020 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPP PP G PPP GG Sbjct: 516 PPPPPMPGTGPPPPPPPMGGVPPPPPPMGGPVPLPPPPAGG 556 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 472 PPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPP 508 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G PPP Sbjct: 495 PPPPMP--GIVGPPPPPMPGIGGPPPPPMPGTGPPPPP 530 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 472 PPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPG 512 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 483 PPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMPG 523 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXG-GXXAXPPPXGG 699 PPP G PPPP P PP G G PPP GG Sbjct: 495 PPPPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPPPPPMGG 535 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 461 PPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPG 501 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 407 GGXPPXXXXFXXGXPPPPPXGGXPP 333 GG PP PPPPP GG PP Sbjct: 514 GGPPPPPMPGTGPPPPPPPMGGVPP 538 >UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: actin binding protein - Entamoeba histolytica HM-1:IMSS Length = 986 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP PPP G Sbjct: 517 PPPPGVPGATGVPPPPPPPGMPGAPPPPPPMGKGMPPPPG 556 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G PPP Sbjct: 516 PPPPPGVPGATGVPPPPPPPGMPGAPPPPPPMGKGMPPPP 555 >UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleostomi|Rep: Wiskott-Aldrich syndrome - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 479 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + PPPP PPPPPPP PP G A PPP Sbjct: 333 RGPPPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPP 372 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPP Q PP G PPP Sbjct: 336 PPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPP 373 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 SQ PPPP PPPPPPP + + + PPP Sbjct: 354 SQSHKPPPPPMGACAPPPPPPPPPPPSSSGNFSSSPVSSAPPP 396 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPPP PP G PPP G Sbjct: 393 PPPPPLPGGGPPPPPPPPP-----PPGLPGAGPPPPPPPPG 428 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP GG PPP Sbjct: 377 PPPPPLPGNTGAPPPPPPP-----PPLPGGGPPPPPPP 409 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP--PP 690 PPPP G PPPPPPP PP G P PP Sbjct: 409 PPPPPGLPGAGPPPPPPPPGCGPPPPPPMGSFGQKPENPP 448 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXP--PPPPP--PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG P PPPPP P PP G PPP G Sbjct: 394 PPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPPMG 438 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 9/47 (19%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT---------PPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP GG PPP Sbjct: 362 PPPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPP 408 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 GG PPPP G PPPPPPP PP G P Sbjct: 400 GGGPPPPPPPPPPPGLPGAG--PPPPPPPPGCGPPPPPPMGSFGQKP 444 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXG 344 PPP P P G P G PPP G PPPPP G Sbjct: 390 PPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPPMG 438 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP PP G A PPP GG Sbjct: 182 PPPPGPPPAPGPPPPPPPP-----PPSGGGAPPAPPPPSGG 217 Score = 37.9 bits (84), Expect(2) = 0.010 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGG 612 PP GGG PP GG GGGGGGG Sbjct: 201 PPSGGGAPPAPPPPSGGGGGGGGGGGGGG 229 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPX----AXGGXXAXPPPXGG 699 PP P G PPPPPPP PP + GG GG Sbjct: 184 PPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGG 228 Score = 24.2 bits (50), Expect(2) = 0.010 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -3 Query: 632 GGGGGGGXXXPPXXXGGGG 576 GGGGGG GGGG Sbjct: 262 GGGGGGSSGGGGGGGGGGG 280 >UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 359 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP GG PPPPPPP PP A G PPP G Sbjct: 78 PPPPPPGGELPPPPPPPPGGYGAPPPAWG----PPPPSG 112 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPP PPP P A GG PPP Sbjct: 89 PPPPPPPGGYGAPPPAWGPPP-----PSGAPGGWGPPPPP 123 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPPP Sbjct: 107 PPPPSGAPGGWGPPPPPPP 125 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPP 630 GG GA PPP GG PPPPPP Sbjct: 96 GGYGAPPPAWGPPPPSGAPGGWGPPPPPPP 125 >UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 404 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 A S+ PPPP GG PPPPPPP P G P GG Sbjct: 330 ASKSEAATPPPPPPPGGAGPPPPPPPPPPGLPAPPPPPGLPGVDGPDGG 378 >UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 2195 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 A S+ PPPP GG PPPPPPP P G P GG Sbjct: 941 ASKSEAATPPPPPPPGGAGPPPPPPPPPPGLPAPPPPPGLPGVDGPDGG 989 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPPPP PP G + PPP Sbjct: 458 PPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPPP 494 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +1 Query: 544 GGGAFXSQKKXPPP--PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPP P G PPPPPP PP G PPP Sbjct: 443 GPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPP 493 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPPPP PP G + PPP Sbjct: 480 PPPLPGSGTISPPPPPPP-----PPLPGTGAVSPPPP 511 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 +Q PPPP G PPPPP P+ PP + P GG Sbjct: 523 TQPPPPPPPPLPGMCPVPPPPPLPRAGQIPPPPPLPGFSVPSMMGG 568 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 9/58 (15%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPP---------PQXXXTPPXAXGGXXAXPPP 690 G G PPPP G PPPPPP Q PP G PPP Sbjct: 485 GSGTISPPPPPPPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPP 542 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G P PPPPP PP G + PPP Sbjct: 438 PPPLPGPGATSPLPPPPP--PLPPPLPGSGTTSPPPP 472 >UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 454 Score = 44.4 bits (100), Expect = 0.004 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP A A PPP Sbjct: 172 PPPPPPASYAAPPPPPPPPASYAAPPPAPPASYAAPPP 209 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT--PPXAXGGXXAXPPP 690 PPPP PPPPPPP PP A PPP Sbjct: 159 PPPPAHPAAYGAPPPPPPPASYAAPPPPPPPPASYAAPPP 198 >UniRef50_Q4PSF3 Cluster: Proline-rich extensin-like family protein; n=3; Arabidopsis thaliana|Rep: Proline-rich extensin-like family protein - Arabidopsis thaliana (Mouse-ear cress) Length = 249 Score = 44.4 bits (100), Expect = 0.004 Identities = 22/50 (44%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXT-------PPXAXGGXXAXPPPXG 696 KK PPPP G PPPPPPPQ + PP + G PPP G Sbjct: 191 KKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPPPG 240 >UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2; Aspergillus|Rep: Contig An08c0110, complete genome - Aspergillus niger Length = 384 Score = 44.4 bits (100), Expect = 0.004 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP PP A PPP G Sbjct: 191 PPPPPPSASPAAPPPPPPPASAPRPPPAPSRSTPPPPPPPG 231 Score = 37.5 bits (83), Expect = 0.43 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP GG PPPPPPP Sbjct: 5 PPPPPPPGGMGGPPPPPPP 23 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPPPPP PP GG PPP G Sbjct: 2 PPPPPPPP----PPGGMGGPPPPPPPAG 25 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP P PPP P PP G A PP G Sbjct: 203 PPPPPPPASA--PRPPPAPSRSTPPPPPPPGASAPQPPNG 240 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPP PP Sbjct: 260 PPPPPAASAPAAPPPPPPSAPPVAPP 285 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 44.4 bits (100), Expect = 0.004 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP A G PPP Sbjct: 488 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 525 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP-----XAXGGXXAXPPP 690 PPPP G PPPPPPP PP GG PPP Sbjct: 510 PPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPP 552 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 487 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPP 524 >UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like - Strongylocentrotus purpuratus Length = 801 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP-PQXXXTPPXAXG--GXXAXPPPXG 696 PPPP GG PPPPPP P PP G G PPP G Sbjct: 257 PPPPPMMGGAPPPPPPPPGPGGAPPPPPPPGMFGGGGPPPPPG 299 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-----QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP GG PPP Sbjct: 256 PPPPPPMMGGAPPPPPPPPGPGGAPPPPPPPGMFGGGGPPPPP 298 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP PP A G A PPP Sbjct: 598 PPPPPALGGVPPPPPPPP------PPPALGAMGAPPPP 629 Score = 41.9 bits (94), Expect = 0.020 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GA + PPPP G PPPPP P PP A PPP Sbjct: 621 GAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPP 667 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP PP A G PPP G Sbjct: 614 PPPPPALGAMGAPPPPPP-----PPPSAAGLPPPPPPPLPG 649 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-----QXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP G PPP G Sbjct: 641 PPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPPPPMPG 686 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQ----XXXTPPXAXGGXXAXPPP 690 GG PPPP PPPPPPP PP G PPP Sbjct: 605 GGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPP 656 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP---PQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P P PP G PPP Sbjct: 631 PPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPP 671 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 PPPP GG P P PP A GG PPP Sbjct: 575 PPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPP 613 >UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium sp. (strain KMS) Length = 317 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP----PPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPP PPP PP GG PPP GG Sbjct: 13 PPPPQ--GGYPPPPPPGGYPPPPTQGGYPPPHPGGYPPPPPPQGG 55 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 7/47 (14%) Frame = +1 Query: 580 PPPXXXGGXXXP-----PPPPPPQXXXTPPXAXGGXXAXPP--PXGG 699 PPP GG P PPPPPPQ PP A P P GG Sbjct: 30 PPPPTQGGYPPPHPGGYPPPPPPQGGYPPPPQGNYPPAGYPVRPQGG 76 >UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabidopsis thaliana|Rep: Similarity to pherophorin - Arabidopsis thaliana (Mouse-ear cress) Length = 1004 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GG + PP GG PPPPPPP PP GG PPP G Sbjct: 660 GGGKSTNLPSARPPLPGGG---PPPPPPPPGGGPPPPPGGGPPPPPPPPG 706 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 407 GGXPPXXXXFXXGXPPPPPXGGXPP 333 GG PP G PPPPP GG PP Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPP 700 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPPXGGXPP 332 GG PPP G PPPPP GG PP Sbjct: 677 GGPPPPPPP--PGGGPPPPPGGGPPP 700 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 PPPP GG PPP P PP A G Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPPGALG 709 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PP PPPPP A GG P Sbjct: 681 PPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGGNKVHRAP 722 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 44.0 bits (99), Expect = 0.005 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP PPP G Sbjct: 603 PPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPG 643 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP G PPP G Sbjct: 615 PPPPPPPGAGGIPPPPPPPGAGIPPPPP--GVPGIPPPPG 652 Score = 43.2 bits (97), Expect = 0.009 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GA PPPP G PPPPPP PP G PPP G Sbjct: 595 GASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPG 643 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 7/47 (14%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-------QXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP GG PPP G Sbjct: 588 PPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPG 634 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G PPP Sbjct: 529 PPPP---SGTAPPPPPPPPGLVPPPPPPPPGASLVPPP 563 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G PPP Sbjct: 614 PPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPP 651 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXX-----TPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP A G PPP Sbjct: 549 PPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPPP 591 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP PPP G Sbjct: 537 PPPPPPPPGLVPPPPPPPPGASLVPP-------PPPPPPG 569 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ----XXXTPPXAXGGXXAXPPP 690 P PP G PPPPPPP PP G PPP Sbjct: 575 PSPPPGAAGLVPPPPPPPPPGASLVPPPPPPPPGAAGLVPPP 616 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP G PPPPP PP A G PPP G Sbjct: 627 PPPPPPPGAGIPPPPPGVPGIPPPPGAPG---LPPPPPG 662 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPP PP A G PPP G Sbjct: 648 PPPP---GAPGLPPPPPGVPGIPPPPGAPG---LPPPPPG 681 >UniRef50_A4R9P2 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 216 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/52 (40%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAX--GGXXAXPPP 690 GGGG Q++ PP P G PPPP PP GG A PPP Sbjct: 63 GGGGGEGGQQQAPPAPAKDGADGAAPPPPAKDGAAPPPPPAKDGGDAAPPPP 114 Score = 37.5 bits (83), Expect = 0.43 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP GG PPPPPPP Sbjct: 99 PPPPAKDGGDAAPPPPPPP 117 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP GG PPPPPPP PP + G A PP Sbjct: 382 PPPPPGAGGPPMPPPPPPP----PPPPSSGNGPAPPP 414 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXT-----PPXAXGGXXAXPPP 690 + PPPP G PPPPPPP + PP GG PPP Sbjct: 357 RGPPPP----GRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPP 397 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G P PPPPP PP PPP G Sbjct: 368 PPPPPPATGRSGPLPPPPP-GAGGPPMPPPPPPPPPPPSSG 407 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 G GG PPPP G PPP PP A GG Sbjct: 387 GAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGG 429 >UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eutheria|Rep: Protein diaphanous homolog 2 - Homo sapiens (Human) Length = 1101 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPP 332 PPP P P G P G PPP G PPPPP GG PP Sbjct: 563 PPPPPAPPLPGGAPLPPPPPPLPGMM-GIPPPPPPPLLFGGPPPPPPLGGVPP 614 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP PPP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP-PQXXXTPPXAXG----GXXAXPPPXGG 699 PP P GG PPPPPP P PP G PPP GG Sbjct: 566 PPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGG 611 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPP P PPP G Sbjct: 578 PPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPPG 617 >UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=1; Xenopus tropicalis|Rep: Wiskott-Aldrich syndrome protein (WASp). - Xenopus tropicalis Length = 451 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP GG PPPPPPP PP G PPP G Sbjct: 349 PPPTARSGGP--PPPPPPPPSIPAPPPTSGPAPPPPPPVSG 387 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP A G PPP Sbjct: 326 PPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPPP 363 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAX--GGXXAXPPP 690 PPP G PPPPP PP GG PPP Sbjct: 326 PPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPPPP 364 >UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1; Pseudomonas entomophila L48|Rep: Insecticidal toxin, SepC/Tcc class - Pseudomonas entomophila (strain L48) Length = 990 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP G PPPPPPP TPP G PPP G Sbjct: 702 PPPPPPSGMRLPPPPPPP-GMGTPPPPPPGMGLPPPPPG 739 >UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Diaphanous - Aedes aegypti (Yellowfever mosquito) Length = 1014 Score = 43.6 bits (98), Expect = 0.007 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP--PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPP P PP G PPP G Sbjct: 445 PPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGGAPRPPPMPG 487 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 Q PPPP G PPPPPP PP Sbjct: 428 QINIPPPPQMPGMGPPPPPPPPGSGGGMPP 457 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 43.2 bits (97), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP TPP A PPP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP A PPP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 PPPP PPP PPP PP + G Sbjct: 1429 PPPPPPPPPPPTPPPAPPPPPPPPPPISSG 1458 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PP P GG PPPPPPP PP G PPP G Sbjct: 273 PPAPSAKGGAPPPPPPPPPPPPPPPPPPKG---VPPPPRG 309 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S K PPP PPPPPPP+ PP G PPP Sbjct: 277 SAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPR---GPPPPPPP 316 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 Q+ PPPP PPPPPP PP PPP G Sbjct: 267 QQVVPPPPAPSAKGGAPPPPPP--PPPPPPPPPPPPKGVPPPPRG 309 >UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding; n=1; Yarrowia lipolytica|Rep: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding - Yarrowia lipolytica (Candida lipolytica) Length = 1851 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP GG PPPPPPP PP G PPP G Sbjct: 1059 PPPMFTGGPPPPPPPPPPGFTGGPPPP--GFTGGPPPPG 1095 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP PP GG PPP Sbjct: 1091 PPPPGFTGGPPPPPPPPP-----LPPGFTGG---PPPP 1120 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPPP 690 +K+ P G PPPPPPP T PP GG PPP Sbjct: 1029 EKENAHSPVKFTGGPPPPPPPPPPPMFTGGPPPMFTGGPPPPPPP 1073 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG + PPPP G PPPP PP GG PPP Sbjct: 1057 GGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPP 1106 Score = 35.5 bits (78), Expect = 1.7 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPP 332 PPP P G P F GG PPP F G PPPPP PP Sbjct: 1070 PPPPPPPGFTGGPP--------PPGFTGGPPPPG---FTGGPPPPPPPPPLPP 1111 Score = 33.1 bits (72), Expect = 9.3 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXX---FFXXGXPPPPPXGGXPPXXF 323 PPP P G P F GG PPP F G PPP GG PP F Sbjct: 1047 PPPPPPPMFTGGPP---------PMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGF 1096 >UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 305 Score = 43.2 bits (97), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P G PPPPPPP PP G A PPP Sbjct: 71 PPRPPPPPGYGEPPPPPPPGYGEQPPPPPPGYAAEPPP 108 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP G PPPPPP PP G PPP G Sbjct: 83 PPPPPPPGYGEQPPPPPPGYAAEPPPPPPGMQPPPPPPG 121 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G PPP Sbjct: 83 PPPPPPPGYGEQPPPPPPGYAAEPPPPPPGMQPPPPPP 120 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP PP G PPP G Sbjct: 74 PPPPPGYG--EPPPPPPPGYGEQPPPPPPGYAAEPPPPPPG 112 >UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 191 Score = 42.7 bits (96), Expect = 0.011 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPP + PP G PPP G Sbjct: 105 PPPPPPRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPPRDG 145 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP PP G PPP G Sbjct: 138 PPPPPRDGSSPRPPPPRDGSSPPPPPPRDGSSPPPPPPRDG 178 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 S++ PPP G PPPP PP G PPP G Sbjct: 122 SKRAASPPPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPPPRDG 167 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 P PP G PPPPP PP G PPP G Sbjct: 148 PRPPPPRDGSSPPPPPPRDGSSPPPPPPRDGSAPPPPPSG 187 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 P PP G PPPPPP PP A PPP G Sbjct: 95 PAPPPRDGSS--PPPPPPRDGSSPPPPPPSKRAASPPPPG 132 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPPP PP A PPP G Sbjct: 150 PPPPRDGSS--PPPPPPRDGSSPPPPPPRDGSAPPPPPSG 187 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 +++ PPP G PPPP PP G PPP G Sbjct: 68 NKRSASPPPPRDGSSPPPPPPRDGASPPAPPPRDGSSPPPPPPRDG 113 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G P PPP PP G PPP Sbjct: 83 PPPPPPRDGASPPAPPPRDGSSPPPPPPRDGSSPPPPP 120 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP PP G PPP Sbjct: 137 PPPPPPRDGSSPRPPPPRDGSSPPPPPPRDGSSPPPPP 174 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP P G PPPPP PP + PPP G Sbjct: 94 PPAPPPRDGSSPPPPPPRDGSSPPPPPPSKRAASPPPPGDG 134 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPP PP G PPP G Sbjct: 116 PPPPPPSKRAASPPPPGDGSSPPPPPPRDGSSPRPPPPRDG 156 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 7/48 (14%) Frame = +1 Query: 577 PPPPXXXGGXXXP-------PPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP P PPPPPP+ +PP A PP G Sbjct: 85 PPPPRDGASPPAPPPRDGSSPPPPPPRDGSSPPPPPPSKRAASPPPPG 132 >UniRef50_A4TTL3 Cluster: Putative uncharacterized protein; n=2; cellular organisms|Rep: Putative uncharacterized protein - Magnetospirillum gryphiswaldense Length = 374 Score = 42.7 bits (96), Expect = 0.011 Identities = 39/97 (40%), Positives = 40/97 (41%), Gaps = 2/97 (2%) Frame = -3 Query: 602 PPXXXGGGGXFFXXKK--APPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXF 429 PP GGGG FF KK PPPP KKK F PP P F F Sbjct: 66 PPPRRGGGGVFFYKKKRGGPPPPPTTQKKKNF-----FFSPP-------PPPSFWGX--F 111 Query: 428 FXXXFXXGGXPPXXXXFXXGXPPPPPXGGXPPXXFFF 318 F PP G PPPP GG PP FF+ Sbjct: 112 FGGGGGFVXXPPRG-----GAPPPP--GGAPPPLFFW 141 Score = 36.3 bits (80), Expect = 1.00 Identities = 38/119 (31%), Positives = 38/119 (31%), Gaps = 5/119 (4%) Frame = +3 Query: 519 FFFXXXX--GGGGGFFXXKKX---PPPPXXXXGXXXAXXXXXXXXXXXXXTXXGGGXGPX 683 FFF GGGG FF KK PPPP GGG Sbjct: 62 FFFPPPPRRGGGGVFFYKKKRGGPPPPPTTQKKKNFFFSPPPPPSFWGXFFGGGGGFVXX 121 Query: 684 PPXGGXXXXPPXRGGXXXXXXXXXXXXXXXXXXXXAXGGGXFXXXGPPPPXKKXKKXSP 860 PP GG PP GG GG GPPP KK K P Sbjct: 122 PPRGGA---PPPPGGAPPPLFFWGGKRGKKTPPPTHKKGG-----GPPPREKKKKHPPP 172 Score = 36.3 bits (80), Expect = 1.00 Identities = 25/65 (38%), Positives = 26/65 (40%), Gaps = 5/65 (7%) Frame = +1 Query: 520 FFFXXXX--GGGGAFXSQKKX---PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 FFF GGGG F +KK PPPP PPPP GG Sbjct: 62 FFFPPPPRRGGGGVFFYKKKRGGPPPPPTTQKKKNFFFSPPPPPSFWGXFFGGGGGFVXX 121 Query: 685 PPXGG 699 PP GG Sbjct: 122 PPRGG 126 Score = 34.7 bits (76), Expect = 3.0 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKK 519 PP GG A PP WGG G P GGG KK PPP KK Sbjct: 122 PPRGG--APPPPGGAPPPLFFWGGKRGKKTPPPTHKKGGGPPPREKKKKHPPPPSFVGKK 179 >UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-PA - Drosophila melanogaster (Fruit fly) Length = 993 Score = 42.7 bits (96), Expect = 0.011 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPPP PP G PPP G Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSG 474 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPP PP G PPP G Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSG 474 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP G PPPPPP PP G PPP G Sbjct: 446 PPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSG 484 Score = 41.5 bits (93), Expect = 0.026 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP PP G PPP G Sbjct: 446 PPPPPPSGNYG--PPPPPPSGNYGPPPPPSGNYGPPPPPSG 484 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP------PPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPP PPPP PP G PPP G Sbjct: 448 PPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSG 494 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PP PPPPP PP G PPP Sbjct: 459 PPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G AF QK+ PP PPPPP PQ PP PPP Sbjct: 631 GPAFVHQKQFGPP--------GPPPPPEPQYLPPPPPLANVRPLGPPP 670 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 601 GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G PPPPPP PP G PPP Sbjct: 431 GHSGPPPPPPSGNYGPPPPPPSGNYGPPPP 460 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPP PP + G PPP G Sbjct: 385 PPPPPPVGG----PPPPPPPIEGRPPSSLGNPPPPPPPGRG 421 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPPP PP G PPP Sbjct: 347 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP 388 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 S+ PPPP G PPPPP PP + G A PPP G Sbjct: 330 SRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG---APPPPSMG 372 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PP PPPPP PP PPP Sbjct: 307 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPP 348 Score = 34.3 bits (75), Expect = 4.0 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -3 Query: 614 GXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXX 435 G PP G + APPPP P PP P Sbjct: 304 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRP-PPPS 362 Query: 434 XFFXXXFXXGGXPPXXXXFXXGXPPPPPXGGXPP 333 G PP PPPPP GG PP Sbjct: 363 RGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPP 396 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 42.3 bits (95), Expect = 0.015 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP G PP G Sbjct: 974 PPPPPPFPGMTPPPPPPPPGCGPPPPPLPPGIGPPPPFMG 1013 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G PPP Sbjct: 963 PPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCGPPPPP 1000 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 K PPPP G PPPP P PP G PPP G Sbjct: 951 KAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPG 993 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP PPP G Sbjct: 975 PPPPPFPG--MTPPPPPPPPGCGPPPPPLPPGIGPPPPFMG 1013 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP G PPPPP P PP G PPP Sbjct: 951 KAPPPPPLP--GMVPPPPPPLPGMAPPPPPPFPGMTPPPPP 989 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G P PPPPP PP G PPP G Sbjct: 916 PPPPPLSGMTPPKPTGVIPPPPPLPGFVPPPPVVGKAPPPPPLPG 960 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 944 PPPPVV--GKAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPG 982 Score = 33.9 bits (74), Expect = 5.3 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPP-PXGGXPPXXFFFF 314 PPP P P F G PPP G PPPP P G PP F Sbjct: 955 PPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCGPPPPPLPPGIGPPPPFMGM 1014 Query: 313 SP 308 P Sbjct: 1015 GP 1016 Score = 33.5 bits (73), Expect = 7.0 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = -1 Query: 511 PXXXXFXPPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXF--FXXGXPPPPPXGGX 338 P F PPP P P G PPP F PPPPP G Sbjct: 937 PPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCGP 996 Query: 337 PP 332 PP Sbjct: 997 PP 998 >UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 protein; n=2; Danio rerio|Rep: PREDICTED: similar to LOC495114 protein - Danio rerio Length = 904 Score = 42.3 bits (95), Expect = 0.015 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G + PPP Sbjct: 322 PPPPPGPAGLFSPPPPPPP-----PPPGFAGLASPPPP 354 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 G G F PPPP G PPPPPPP + P G Sbjct: 327 GPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPPG 368 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/57 (36%), Positives = 23/57 (40%), Gaps = 6/57 (10%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXT------PPXAXGGXXAXPPPXG 696 G G+ PPPP G PPPPPPP PP G + PPP G Sbjct: 312 GLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPPG 368 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G + PPP Sbjct: 304 PPPPPPVPGLGSAPPPPPP----PPPPGPAGLFSPPPP 337 >UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: FH2 domain protein - Entamoeba histolytica HM-1:IMSS Length = 1212 Score = 42.3 bits (95), Expect = 0.015 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G PPP Sbjct: 636 PPPPPPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMPPP 674 Score = 41.9 bits (94), Expect = 0.020 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G PPP Sbjct: 624 PPPPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPP 662 Score = 41.9 bits (94), Expect = 0.020 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPP P PP G PPP G Sbjct: 660 PPPPPPPGMPGMPPPPPLPGMPGMPPPPPGMPGMPPPPPG 699 Score = 40.7 bits (91), Expect = 0.046 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP G + PPP Sbjct: 613 PPPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPP 650 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPP PP G PPP G Sbjct: 649 PPPPPPGMPGMPPPPPPPGMPGMPPPPPLPGMPGMPPPPPG 689 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP G PPP Sbjct: 614 PPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPP 651 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG--GXXAXPPPXG 696 PPPP PPPPP PP G G PPP G Sbjct: 626 PPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPPPPPPG 667 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP G PPPPPPP PP PPP G Sbjct: 613 PPPPPPGASSVPPPPPPPGASSVPPP--------PPPPG 643 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP G PPP Sbjct: 638 PPPPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMPPPP 675 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S K PPP PPPPPP PP G + PPP Sbjct: 598 SPKGVVPPPSNTA--TAPPPPPPGASSVPPPPPPPGASSVPPP 638 >UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whole genome shotgun sequence; n=7; Euteleostomi|Rep: Chromosome undetermined SCAF14625, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 496 Score = 42.3 bits (95), Expect = 0.015 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 6/61 (9%) Frame = +1 Query: 526 FXXXXGGGGAFXSQ--KKXPPPPXXXGGXXXPPPPPPPQ----XXXTPPXAXGGXXAXPP 687 F GG A S+ ++ PPPP GG PPPPPP + PP + A PP Sbjct: 258 FIQRTGGVEAVRSELRRRAPPPPPGRGGAPPPPPPPPARGSRGAPPPPPPSRAPASAPPP 317 Query: 688 P 690 P Sbjct: 318 P 318 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 8/49 (16%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP--------PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP P T P + G PP G Sbjct: 290 PPPPPARGSRGAPPPPPPSRAPASAPPPPPPTRPGSLGAPPPPPPTTRG 338 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP A PPP Sbjct: 316 PPPPPTRPGSLGAPPPPPPTTRGGHQVAPPHQKTPPPP 353 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQ------XXXTPPXAXGGXXAXPP 687 S+ PPPP PPPPPP + PP GG PP Sbjct: 298 SRGAPPPPPPSRAPASAPPPPPPTRPGSLGAPPPPPPTTRGGHQVAPP 345 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP-PXG 696 AF + PPPP G PPPPPPP P G PP P G Sbjct: 1075 AFIAAPPPPPPPAPVTGPTPPPPPPPPPPPPPPAPVTGPTPPAPPLPPG 1123 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GGG S + PPP PPPPPP T P PPP Sbjct: 1055 GGGQQLQSPEFPPPPADTSAAFIAAPPPPPPPAPVTGPTPPPPPPPPPPP 1104 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXX--PPPPPPPQ--XXXTPPXAXGGXXAXPPP 690 GGG + PPPP PPPPPPP TPP PPP Sbjct: 1055 GGGQQLQSPEFPPPPADTSAAFIAAPPPPPPPAPVTGPTPPPPPPPPPPPPPP 1107 Score = 32.7 bits (71), Expect(2) = 3.3 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 ++ PPP PPPPPPP P PPP Sbjct: 940 EESPPPAPTPSPPPPPPPPPPPPPPPPPQQQFQLPSQFPPP 980 Score = 20.6 bits (41), Expect(2) = 3.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 547 GGAFXSQKKXPPPP 588 GG+F PPPP Sbjct: 889 GGSFPPPPPPPPPP 902 >UniRef50_Q10AA9 Cluster: La domain containing protein, expressed; n=5; Oryza sativa|Rep: La domain containing protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 381 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 GGGG F + + P P G PPPPPPP PP Sbjct: 117 GGGGGFDALYRAPIGPYVRGATAPPPPPPPPMAVAPPP 154 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 42.3 bits (95), Expect = 0.015 Identities = 26/89 (29%), Positives = 28/89 (31%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKFXX 756 PPPP G PPPPPP P PPP G QK Sbjct: 548 PPPPPLPGQHKQTPPPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQK--TG 605 Query: 757 XXXHRXXPXXGRXGGGXXXXXAPPPPXKK 843 P G+ G PPPP +K Sbjct: 606 PPPPPPPPLPGQKAGAPPPPPPPPPPGQK 634 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP PP G PP GG Sbjct: 609 PPPPPLPGQKAGAPPPPPPP----PPPGQKGIPPPPPTFGG 645 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 QK PPPP G PPPPPP P G PPP G Sbjct: 576 QKTGPPPPPPLPGQKAGPPPPPP----LPGQKTGPPPPPPPPLPG 616 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +1 Query: 577 PPPPXXX---GGXXXPPPPPPP--QXXXTPPXAXGGXXAXPP 687 PPPP G PPPPPPP + PP GG A P Sbjct: 610 PPPPLPGQKAGAPPPPPPPPPPGQKGIPPPPPTFGGANAKGP 651 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP+ PP A PPP Sbjct: 607 PPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPP 644 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPP PP G A PPP G Sbjct: 659 PPPPPPPGSKAGGPPPPPPPGAPQPP----GGSAPPPPFG 694 Score = 39.5 bits (88), Expect = 0.11 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP--PPPPPQXXXTPPXAXGGXXAXPPPXG 696 K PPPP G PP PPPPP PP + G PPP G Sbjct: 639 KAGPPPPPPPPGVPRPPGGPPPPP----PPPGSKAGGPPPPPPPG 679 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP---PQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPPP PP G PPP G Sbjct: 608 PPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPG 650 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 8/48 (16%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP--------PXAXGGXXAXPPPXG 696 PPPP PPPPPPP P P GG PPP G Sbjct: 619 PPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPG 666 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P P PP G A PP Sbjct: 634 PPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPP 673 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXP 335 PPP P G P G PPP G PPPPP G P Sbjct: 630 PPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAP 681 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 G + SQ PP PPPPPPP + PP A PPP Sbjct: 584 GPSNTSQSVPQQPPNAPSLPPPPPPPPPPVKSAPLPPPPPPPKIAAPPP 632 >UniRef50_Q9NSV4 Cluster: Protein diaphanous homolog 3; n=66; Deuterostomia|Rep: Protein diaphanous homolog 3 - Homo sapiens (Human) Length = 1193 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GG S PPP GG PPPPPPP G PPP G Sbjct: 568 GGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPPPLG 617 >UniRef50_P22357 Cluster: Anther-specific protein SF18 precursor; n=3; core eudicotyledons|Rep: Anther-specific protein SF18 precursor - Helianthus annuus (Common sunflower) Length = 161 Score = 42.3 bits (95), Expect = 0.015 Identities = 23/52 (44%), Positives = 24/52 (46%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPP 543 PP G G + P A GG GG GGGG P GGGG APPP Sbjct: 104 PPGGDGGSGPAPPAGGGSPPPAGGDGGGGAPPPAGGDGGGG-------APPP 148 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP P GG P PP PP G PPP GG Sbjct: 99 PPTPSPPGGDGGSGPAPPAGGGSPPPAGGDGGGGAPPPAGG 139 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G G A + PPP GG PPP PP A G PPP Sbjct: 110 GSGPAPPAGGGSPPPAGGDGGGGAPPPAGGDGGGGAPPPAGGDGGGAPPP 159 Score = 35.5 bits (78), Expect = 1.7 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPP 543 PP GGG GG GG GGG PP GGG APPP Sbjct: 115 PPAGGGSPPPAGGDGGGGAPPPAGGDGGGGAPPPAGGDGGG-------APPP 159 Score = 34.7 bits (76), Expect = 3.0 Identities = 28/97 (28%), Positives = 29/97 (29%), Gaps = 8/97 (8%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPP--------PPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXX 720 QK PPP G PP P P P +PP GG PP GG Sbjct: 68 QKNPGPPPGAPGTPGTPPAPPGKGEGDAPHPPPTPSPPGGDGGSGPAPPAGGGSPPPAGG 127 Query: 721 XXXXRQQKKFXXXXXHRXXPXXGRXGGGXXXXXAPPP 831 P G GGG APPP Sbjct: 128 DGGGGAPPPAGGDGGGGAPPPAGGDGGG-----APPP 159 >UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|Rep: Diaphanous homologue - Gallus gallus (Chicken) Length = 1253 Score = 41.9 bits (94), Expect = 0.020 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP------PPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPP PPP PP GG PPP GG Sbjct: 714 PPPPPLPGGTIPPPPPLFGGAVPPP-----PPLPGGGAGPPPPPPGG 755 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP----QXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPP P PP GG PPP G Sbjct: 688 PPPPLLPGGTVIPPPPPLPGGAAAVLPPPPPLPGGTIPPPPPLFG 732 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP GG PPP Sbjct: 624 PPPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPP 664 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPPP 690 PPPP G PPPPP P PP GG PPP Sbjct: 637 PPPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPP 677 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP GG PPP Sbjct: 650 PPPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPP 690 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPPP 690 PPPP G PPPPP P PP GG PPP Sbjct: 663 PPPPLPGGAAVIPPPPPLPGGAAVIPPPPLLPGGTVIPPPP 703 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +1 Query: 577 PPPPXXXGGXXX---PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPP P PP GG PPP G Sbjct: 700 PPPPPLPGGAAAVLPPPPPLPGGTIPPPPPLFGGAVPPPPPLPG 743 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 PPPP GG PPPP P PP GG P Sbjct: 725 PPPPPLFGGAVPPPPPLPGGGAGPPPPPPGGPPMAP 760 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 P PP G PPPPP P PP GG PPP Sbjct: 611 PAPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPP 651 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP--PXAXGGXXAXPPP 690 PPPP GG PP PP P P P GG P P Sbjct: 574 PPPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVPPAP 613 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 PP P GG PP PP P PP GG PPP Sbjct: 598 PPAPPLPGGTVVPPAPPLPGGAAVIPPPPPLPGGAAVIPPP 638 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P PP GG A PP Sbjct: 676 PPPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPP 715 >UniRef50_Q2H982 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 173 Score = 41.9 bits (94), Expect = 0.020 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 GGGG+ + PPPP G PPPPPPP Sbjct: 93 GGGGSSPRPQPPPPPPPPQPGLPPPPPPPPP 123 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 GGG + Q PPPP G PPPPPPP Sbjct: 94 GGGSSPRPQPPPPPPPPQPGLPPPPPPPPPP 124 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPP PP G PPP Sbjct: 957 PPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPP 994 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ----XXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP G PPP G Sbjct: 954 PPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPPG 998 >UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morphogenesis 1; n=37; Amniota|Rep: Disheveled-associated activator of morphogenesis 1 - Homo sapiens (Human) Length = 1078 Score = 41.9 bits (94), Expect = 0.020 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPP P PP A PP G Sbjct: 552 PPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPG 591 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPPP GG PP PPP PP A G Sbjct: 565 PPPPLPPGGPPPPPGPPPLGAIMPPPGAPMG 595 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPP-PQXXXTPPXAXGGXXAXPPPXG 696 GG P P G PPPPPP P PP PPP G Sbjct: 529 GGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPG 579 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 41.5 bits (93), Expect = 0.026 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT-----PPXAXGGXXAXP-PPXGG 699 PPPP G PP PPPP T PP GG A P PP GG Sbjct: 614 PPPPPIPGMMTGPPSPPPPPLVATVVGPPPPLPPGGPAALPLPPVGG 660 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP P G PPP G Sbjct: 571 PPPPPMPGMMSGPPPPPPPM----PEMMSGPPPPPPPPMPG 607 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP P G + PPP Sbjct: 600 PPPPPMPGMMSGPPPPPPP-----IPGMMTGPPSPPPP 632 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP P G PPP G Sbjct: 585 PPPPPMPEMMSGPPPPPPPPM----PGMMSGPPPPPPPIPG 621 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP P G PPP Sbjct: 558 PPPPPPMPGIMQPPPPPP------MPGMMSGPPPPPPP 589 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP PP + PPP G Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKG 274 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG F + PPPP P PPPPP PP PPP Sbjct: 200 GGPTFPTPVSAPPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPP 248 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP + PPP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXA--XPPPXG 696 PPPP PPPPPPP PP + PPP G Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKG 274 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S PPPP PPP PPP PP PPP Sbjct: 222 SPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP P P Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNP 269 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 A S PPPP P PPPPP PP PP Sbjct: 221 ASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 >UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12; Magnoliophyta|Rep: H0211F06-OSIGBa0153M17.6 protein - Oryza sativa (Rice) Length = 1510 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PP PP PP GG PPP GG Sbjct: 1186 PPPPRGHGGVGGPPTPPGAPTPPMPPGVPGG---PPPPPGG 1223 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP GG PPPP + PP A GG PPP G Sbjct: 1151 PPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRG 1191 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 586 PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P GG PP PPPPQ T GG PPP Sbjct: 1053 PGEVGGAPSPPSPPPPQRENTSVGIQGGIPPLPPP 1087 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP PP GG P Sbjct: 1099 PPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLGGHQAP 1136 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPPP PP PPP GG Sbjct: 1099 PPPPSIGAGAPPPPPPPGGITGVPP---------PPPIGG 1129 >UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 444 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 PP GGG P GG GGGGGG PP GGGG Sbjct: 91 PPGGGGAPG--PLGGGGARPPGGGGGGGPPSLPPGAGGGGG 129 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -3 Query: 695 PXGGGXAXXPPXAXGGVXXXWG-GGGGGGXXXPPXXXGGGG 576 P GGG P A GG G GGGGGG P GGGG Sbjct: 186 PGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGG 226 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -3 Query: 695 PXGGGXAXXPPXAXGGVXXXWG-GGGGGGXXXPPXXXGGGG 576 P GGG A P GG G GGGG PP GGGG Sbjct: 100 PLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGG 140 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGG----GGGGXXXPPXXXGGGG 576 PP GGG P A GG G G GGGG P GGGG Sbjct: 172 PPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGG 216 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG P GG GGGGGGG GGGG Sbjct: 191 GGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGGG 228 Score = 34.7 bits (76), Expect = 3.0 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = +3 Query: 333 GGXPPXGGGGGXPXXKXXXXGGGXPPXKXXXKKXXXXXKGXPXGXXGXXXGGG--KXXXX 506 G PP GGGGG P GGG G P G GGG Sbjct: 105 GARPPGGGGGGGPPSLPPGAGGGG--GARPPAPGGGGGGGAPRRVLGGGGGGGALARPPG 162 Query: 507 XGRXFFFXXXXGGGGG 554 GR GGGGG Sbjct: 163 GGRGGALGRPPGGGGG 178 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 689 GGGXAXXPPXAXGG---VXXXWGGGGGGGXXXPPXXXGGGG 576 GGG PP A GG GGGGGGG GGGG Sbjct: 114 GGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGG 154 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGG-----VXXXWGGGGGGGXXXPPXXXGGGG 576 P GGG PP GG GGGGGGG P G GG Sbjct: 122 PGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGG 167 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAP 549 GGG PP G GGGGG P GGGG +AP Sbjct: 153 GGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAP 199 >UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 1115 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPP PP GG PPP GG Sbjct: 563 PPPPPLPQNLSGAPPPPPP-----PPPMLGGPPPPPPPPGG 598 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 41.5 bits (93), Expect = 0.026 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXX----PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPPP PP + GG PPP GG Sbjct: 726 PPPPPPPGGLPPITGGPPPPPPP--GGLPPIS-GGPPPPPPPPGG 767 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GG A PPPP PPPPPP P GG PPP G Sbjct: 701 GGSSALPPITGGPPPPPGLPPITGGPPPPPPPGGL--PPITGGPPPPPPPGG 750 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = +1 Query: 577 PPP---PXXXGGXXXPPPPP---PPQXXXTPPXAXGGXXAXPPPXG 696 PPP P GG PPPPP PP PP G PPP G Sbjct: 746 PPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPG 791 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPPXGGXPP 332 G PPP G PPPPP GG PP Sbjct: 712 GPPPPPGLPPITGGPPPPPPPGGLPP 737 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +1 Query: 577 PPPPXXXGGXXX---PPPPPPPQ----XXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP PP GG PPP Sbjct: 742 PPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPP 786 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP 651 PPPP GG PPPPPP P Sbjct: 771 PPPPPPPGGFKGGPPPPPPPGMFAP 795 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP PP + PPP G Sbjct: 501 PPPPPPSKSSGPPPPPPPPPKSSGPPPPPPPKSSPPPPADG 541 >UniRef50_Q54ER5 Cluster: Formin homology domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Formin homology domain-containing protein - Dictyostelium discoideum AX4 Length = 2546 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP PP G PPP GG Sbjct: 1065 PPPPGKSSGGGPPPPPPP------PPKGGKGGPPPPPPIGG 1099 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 586 PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P GG PPPPPPP P + GG PPP Sbjct: 1052 PSSSGGPPPPPPPPPP-----PGKSSGGGPPPPPP 1081 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G A PPP Sbjct: 472 PPPPPPPPGKNAPPPPPPP-----PPPPPHGKKAPPPP 504 Score = 34.7 bits (76), Expect = 3.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ 636 PPPP G PPPPPPP+ Sbjct: 490 PPPPPPHGKKAPPPPPPPPK 509 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPPP Sbjct: 489 PPPPPPPHGKKAPPPPPPP 507 >UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: Formin A - Trypanosoma cruzi strain CL Brener Length = 1178 Score = 41.5 bits (93), Expect = 0.026 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXG---GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPPP G G PPPPPPP PP G PPP Sbjct: 642 GAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPP----PPPPGAGAKSGLPPP 689 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPPP G PPPPPP PP A PPP Sbjct: 530 GAGAKSGLPPPPPPPPGAGAKSGLPPPPPP-----PPGAGAKSGLPPPP 573 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPPP G PPPPPP PP A PPP Sbjct: 546 GAGAKSGLPPPPPPPPGAGAKSGLPPPPPP-----PPGAGAKSGLPPPP 589 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPPP G PPPPPP PP A PPP Sbjct: 562 GAGAKSGLPPPPPPPPGAGAKSGLPPPPPP-----PPGAGAKSGLPPPP 605 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPPP G PPPPPP PP A PPP Sbjct: 578 GAGAKSGLPPPPPPPPGAGAKSGLPPPPPP-----PPGAGAKSGLPPPP 621 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPPP G PPPPPP PP A PPP Sbjct: 594 GAGAKSGLPPPPPPPPGAGAKSGLPPPPPP-----PPGAGAKSGLPPPP 637 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPPP G PPPPPP PP A PPP Sbjct: 610 GAGAKSGLPPPPPPPPGAGAKSGLPPPPPP-----PPGAGAKSGLPPPP 653 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GA PPPP G PPPPPP PP A PPP Sbjct: 626 GAGAKSGLPPPPPPPPGAGAKSGLPPPPPP-----PPGAGAKSGLSPPP 669 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP A PPP Sbjct: 525 PPPPPGAGAKSGLPPPPPP-----PPGAGAKSGLPPPP 557 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP A G PPP G Sbjct: 526 PPPPGAGAKSGLPPPPPPPPG----AGAKSGLPPPPPPPPG 562 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 577 PPPPXXXGGXXX--PPPPPPPQXXXTPPXAXGGXXAXP 684 PPPP G PPPPPPP + P G + P Sbjct: 674 PPPPPGAGAKSGLPPPPPPPPPKAKSRPAQTGPTRSIP 711 >UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1254 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P GG PPPPPP PP GG + PP Sbjct: 500 PPAPPLPGGSAPPPPPPPGGSVPPPPPLPGGTCSSGPP 537 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP G PPPPP PP G + PPP Sbjct: 501 PAPPLPGGSAPPPPPPPGGSVPPPPPLPGGTCSSGPPP 538 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 S++ PPP P PP P PP GG PPP G Sbjct: 484 SRQSAPPPKPVARASAPPAPPLPGGSAPPPPPPPGGSVPPPPPLPG 529 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F ++ PPP PP PP P PP G PPP Sbjct: 481 FAVSRQSAPPPKPVARASAPPAPPLPGGSAPPPPPPPGGSVPPPP 525 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP GG PPPPPPP P A GG PPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPM----PGRAGGGPPPPPPP 545 Score = 39.9 bits (89), Expect = 0.081 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 7/60 (11%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXG--GXXXPPPPPPPQXXXT-----PPXAXGGXXAXPPPXGG 699 GGGGA PPPP G G PPPPPPP PP G PPP G Sbjct: 519 GGGGA-----PPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG---XXAXPPP 690 PPPP PPPPPPP PP G PPP Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPP 583 >UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L splicing variant; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to FHOS2L splicing variant - Strongylocentrotus purpuratus Length = 1146 Score = 41.1 bits (92), Expect = 0.035 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP A G A PPP Sbjct: 582 PPPPPPLPGLGIPPPPPIPGAPPPPPPPAMKGPGAPPPP 620 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 406 GXPPPXXXFFXXGXPPPPPXGGXPP 332 G PPP G PPPPP G PP Sbjct: 580 GAPPPPPPLPGLGIPPPPPIPGAPP 604 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXG----GXXAXPPP 690 G A + PPPP PPPPPPPQ PP G A PPP Sbjct: 905 GSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALPPP 956 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPPQ + A G A PPP Sbjct: 892 PPPPPPPQPPPSSGSAPGAPPAPPPP 917 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 S+ PPPP PPPPPP P A PPP G Sbjct: 921 SEAPLPPPPPPPPQAALPPPPPP-GPPPAPDAALPPPPPAPPPPG 964 >UniRef50_Q2V2M9-2 Cluster: Isoform 2 of Q2V2M9 ; n=9; Amniota|Rep: Isoform 2 of Q2V2M9 - Homo sapiens (Human) Length = 1401 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP G PPP Sbjct: 808 PPPPPPPTFLGLPPPPPPPLLDSIPPPPVPGNLLVPPP 845 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G PPP Sbjct: 811 PPPPTFLG--LPPPPPPPLLDSIPPPPVPGNLLVPPPP 846 >UniRef50_Q5C3I4 Cluster: SJCHGC03138 protein; n=2; Schistosoma japonicum|Rep: SJCHGC03138 protein - Schistosoma japonicum (Blood fluke) Length = 156 Score = 41.1 bits (92), Expect = 0.035 Identities = 28/77 (36%), Positives = 28/77 (36%), Gaps = 17/77 (22%) Frame = -1 Query: 472 PXXPXGXPFXXKXXFFXXXFX---------GGXPPPXXXFFXXGXPPPPPXGGXP----- 335 P P G PF FF F G PPP FF PPPP GG P Sbjct: 2 PHPPWGVPFWGGFFFFRGVFPPRGGPLFFYGAPPPPPPFFFNKKKRPPPPPGGPPPPFGG 61 Query: 334 ---PXXFFFFSPGXXGV 293 P F FF P GV Sbjct: 62 GGFPPFFHFFPPPGGGV 78 Score = 40.7 bits (91), Expect = 0.046 Identities = 44/129 (34%), Positives = 44/129 (34%), Gaps = 4/129 (3%) Frame = -3 Query: 668 PPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKKXXPXXXXXFX 489 PP GV WGG PP GG FF PPPP KKK P Sbjct: 1 PPHPPWGVPF-WGGFFFFRGVFPPR---GGPLFFYGAPPPPPPFFFNKKKRPP------- 49 Query: 488 PPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXF-XXGXPPPPPXGGXPP---XXFF 321 PP P P P F GG PP F G PP GG PP F Sbjct: 50 PP----PGGPPPP-----------FGGGGFPPFFHFFPPPGGGVAPPQGGGPPLGGGGFQ 94 Query: 320 FFFPXXXXG 294 FFF G Sbjct: 95 FFFKGFLPG 103 Score = 37.1 bits (82), Expect = 0.57 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 8/71 (11%) Frame = +1 Query: 511 GXXFFFXXXXG--GGGAFXSQKKXPPPPXXXGGXXXPPPPP--PPQXXXTPPXAXGGXXA 678 G FFF GG F PPPP PPPPP PP PP GG Sbjct: 12 GGFFFFRGVFPPRGGPLFFYGAPPPPPPFFFNKKKRPPPPPGGPP-----PPFGGGGFPP 66 Query: 679 ----XPPPXGG 699 PPP GG Sbjct: 67 FFHFFPPPGGG 77 >UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; Dictyostelium discoideum|Rep: Wiscott-Aldrich syndrome protein - Dictyostelium discoideum AX4 Length = 399 Score = 41.1 bits (92), Expect = 0.035 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + PPPP G PPPPP + PP G PPP Sbjct: 260 RSAPPPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPPPP 300 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 K P P GG PPPPPPP PP A P GG Sbjct: 282 KTPAAPPSGGGAPPPPPPPPPPSSGPPPPPPPMASAPPSSGGG 324 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 S K PP G PPPPPPP PP + PP GG Sbjct: 280 SHKTPAAPPSGGGAPPPPPPPPPPSSGPPPPPPP--MASAPPSSGG 323 Score = 36.3 bits (80), Expect = 1.00 Identities = 20/42 (47%), Positives = 21/42 (50%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 GGGA PPPP G PPPPPPP PP + GG Sbjct: 290 GGGA---PPPPPPPPPPSSG---PPPPPPPM-ASAPPSSGGG 324 >UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 994 Score = 41.1 bits (92), Expect = 0.035 Identities = 36/129 (27%), Positives = 38/129 (29%), Gaps = 8/129 (6%) Frame = +1 Query: 337 GXPPXGGG--GGXPXKKXXXXGGXPPXKKXXXKXLXXXKKGXXGXXGXXKXGGXKXXXXX 510 G PP G G GG P GG PP G G G Sbjct: 521 GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 580 Query: 511 GXXFFFXXXXGGGGAFXSQ------KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGX 672 G + G G Q + PPPP G PPPP Q PP G Sbjct: 581 GAGQGWGQPPPGAGQGWGQPPPGAGQGGPPPPG--AGQEGPPPPGAGQGGGPPPPGAGQG 638 Query: 673 XAXPPPXGG 699 PPP G Sbjct: 639 WGLPPPGSG 647 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 GGG Q PPP GG PPPP Q PP G PPP G Sbjct: 515 GGGQGWGQ---PPPGAGQGG--GPPPPGAGQGGGPPPPGAGQGWGQPPPGAG 561 Score = 34.7 bits (76), Expect = 3.0 Identities = 34/123 (27%), Positives = 36/123 (29%), Gaps = 5/123 (4%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWG----GGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXX 531 PP G G PP G WG G G GG PP GGG PPP Sbjct: 534 PPPGAGQGGGPPPPGAG--QGWGQPPPGAGQGGGPPPPGAGQGGG-------PPPPGAGQ 584 Query: 530 XKKKXXPXXXXXF-XPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFXXGXPPPP 354 + P + PP P P GG PP PPP Sbjct: 585 GWGQPPPGAGQGWGQPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 644 Query: 353 PXG 345 G Sbjct: 645 GSG 647 Score = 33.5 bits (73), Expect = 7.0 Identities = 34/134 (25%), Positives = 40/134 (29%), Gaps = 3/134 (2%) Frame = +3 Query: 333 GGXPPXGGGGGXPXXKXXXXGGGXPP---XKXXXKKXXXXXKGXPXGXXGXXXGGGKXXX 503 G PP G GG P GGG PP + + +G G GGG Sbjct: 521 GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 580 Query: 504 XXGRXFFFXXXXGGGGGFFXXKKXPPPPXXXXGXXXAXXXXXXXXXXXXXTXXGGGXGPX 683 G+ + G G G+ PPP G G G GP Sbjct: 581 GAGQG-WGQPPPGAGQGW-----GQPPPGAGQG---GPPPPGAGQEGPPPPGAGQGGGPP 631 Query: 684 PPXGGXXXXPPXRG 725 PP G P G Sbjct: 632 PPGAGQGWGLPPPG 645 >UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 479 Score = 41.1 bits (92), Expect = 0.035 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP GG P P Sbjct: 361 PPPPAAAAPPPPPPPPPPAGLPPPPKTGGGGPIAPKP 397 >UniRef50_Q6CAY8 Cluster: Similarity; n=2; Fungi/Metazoa group|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 586 Score = 41.1 bits (92), Expect = 0.035 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 S++K PPP G PPP PPP PP G PP G Sbjct: 134 SREKHAPPPGPPPGLYAPPPGPPPGHHAPPPGPPPGHDGFAPPPG 178 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +1 Query: 562 SQKKXPPP---PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 S+K PPP P PPP PPP PP G A PP Sbjct: 120 SEKHAPPPGPPPGHSREKHAPPPGPPPGLYAPPPGPPPGHHAPPP 164 >UniRef50_A0JLT2 Cluster: Mediator of RNA polymerase II transcription subunit 19; n=31; Euteleostomi|Rep: Mediator of RNA polymerase II transcription subunit 19 - Homo sapiens (Human) Length = 244 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F +Q PPPP G PPPPP PP A GG PPP Sbjct: 8 FGAQADPPPPPTALGFGPGKPPPPP------PPPAGGGPGTAPPP 46 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 41.1 bits (92), Expect = 0.035 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 PPPP G PPPPPPP PP A G Sbjct: 591 PPPPPGTDGPVPPPPPPPPPPPGGPPDALG 620 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPPPP T PPP GG Sbjct: 574 PPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGG 614 >UniRef50_Q2V2M9 Cluster: FH1/FH2 domain-containing protein 3; n=31; Deuterostomia|Rep: FH1/FH2 domain-containing protein 3 - Homo sapiens (Human) Length = 1422 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP G PPP Sbjct: 829 PPPPPPPTFLGLPPPPPPPLLDSIPPPPVPGNLLVPPP 866 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G PPP Sbjct: 832 PPPPTFLG--LPPPPPPPLLDSIPPPPVPGNLLVPPPP 867 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT----PPXAXGGXXAXPPP 690 PPP GG PPPPPPP T PP G + PPP Sbjct: 282 PPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMSVPPP 323 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP G PPP G Sbjct: 336 PPPPPRPGNMGVPPPPPPP-----PPGNMGVPPPPPPPPPG 371 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ-----XXXTPPXAXGGXXAXPPP 690 PPPP G PP PPPPQ PP GG PPP Sbjct: 380 PPPPGYTGSSLPPPAPPPPQNASMAPPPPPPPPLGGKFLPPPP 422 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ----XXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G PPP Sbjct: 309 PPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPP 350 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPP 633 S PPPP GG PPPPPPP Sbjct: 402 SMAPPPPPPPPLGGKFLPPPPPPP 425 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP G PPP Sbjct: 297 PPPPGTNTTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLPPP 337 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP PPP G Sbjct: 352 PPPPPGNMGVPPPPPPPPPGNMCIPP-------PPPPPPG 384 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 A+ PPP PPPPPP P GG PPP Sbjct: 252 AYSDLSMLPPPLLPDDDMGDAPPPPPPPSPPPPGSVYGGSLVPPPP 297 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPPP Sbjct: 408 PPPPPLGGKFLPPPPPPPP 426 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT--------PPXAXGGXXAXPPP 690 PPPP G PPPPPP T PP A PPP Sbjct: 363 PPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPPP 408 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 40.7 bits (91), Expect = 0.046 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP +PP PPP Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPP 263 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP + PPP Sbjct: 243 PPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP +PP PPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP PPP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP PPP Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP + PPP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP PPP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP PP PPP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP PP PPP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPP PPP PP PPP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPP 255 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPP PP PPP Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PPP PP PPP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP P P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSP 277 >UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1561 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT----PPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP G A PP G Sbjct: 1037 PPPPPISGAPPPPPPPPPPMKGGAGPPPPPPPPGKLGAKKPPAG 1080 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP P G PPP G Sbjct: 1036 PPPPPPISGAPPPPPPPPP-----PMKGGAGPPPPPPPPG 1070 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP G PPP Sbjct: 1050 PPPPPPMKGGAGPPPPPPPPGKLGAKKPPAGVQCRPPP 1087 >UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1128 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP PP G PPP G Sbjct: 612 PPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPPPPG 654 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPPPP PP PPP G Sbjct: 597 PPPPPVGAPPPPPPPPPP-----PPGVAAAAPPPPPPPPG 631 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP G PPPPPPP PP G A P Sbjct: 637 PPPPV--GAGILPPPPPPPGAPGMPPPPPGMPRAPAP 671 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPP----PPQXXXTPPXAXGGXXAXPPP 690 S + PPP G PPPP PP PP G A PPP Sbjct: 579 SARSQPPPTDLAGAPPVAPPPPPVGAPPPPPPPPPPPPGVAAAAPPP 625 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPPPP P A PPP G Sbjct: 597 PPPPPVGAPPPPPPPPPPP-----PGVAAAAPPPPPPPPG 631 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP PP G PPP G Sbjct: 624 PPPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMPPPPPG 664 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPPPP PP PPP G Sbjct: 367 PPPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPAG 406 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPP PP PPP G Sbjct: 366 PPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPAG 406 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 Q K PPP PPPPPPP PP PPP Sbjct: 359 QNKSAPPP--------PPPPPPPPPKGAPPPPPPPPPPPPPP 392 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP A PPP Sbjct: 47 PPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 Q+ PPPP PPPPPPP PP P P Sbjct: 40 QQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAP 81 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 Q++ PPPP PPPPPPP PP P P Sbjct: 38 QQQQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQP 79 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 Q PPPP PPPPPPP PP PP Sbjct: 41 QPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP PP Sbjct: 1951 PPPPPPPPPTEDPPPPPPPPPAEAPP 1976 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPP + PP PPP Sbjct: 1942 PPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPP 1979 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 Q++ PPP PPPPPPP PP Sbjct: 37 QQQQQPPPPPPPPPASPPPPPPPPPPPPPP 66 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 40.7 bits (91), Expect = 0.046 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP GG PPPPPPP PP Sbjct: 514 PPPPGGMGGVPPPPPPPPPGGMPPPP 539 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP PP A A PP G Sbjct: 513 PPPPPGGMGGVPPPPPPPPPGGMPPPPA----PALPPVDG 548 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P GG PPPPPPP PP GG PPP Sbjct: 499 PPMPAPSGGA--PPPPPPP-----PPGGMGGVPPPPPP 529 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 460 PPPPPLPATSAPPPPPPAPPAPPAPPLPAAHAPPPPPP 497 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 F Q+ PPPP PPPPPP PP PP Sbjct: 377 FTGQRSVPPPPPSRSS--VPPPPPPRNSAAQPPLPPKAPGPAPP 418 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP PP GG P P Sbjct: 511 PPPPPPPGGMGGVPPPPPP-----PP--PGGMPPPPAP 541 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P PP PPPPPP P PPP GG Sbjct: 479 PAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGG 519 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = +1 Query: 577 PPPPXXXGGXXXPP------PPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PP PPPPP P + G PPP G Sbjct: 472 PPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPG 518 >UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; Basidiomycota|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 464 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP GG PPP Sbjct: 310 PPPPVRSDGTGVAPPPPPPPPPARPP---GGAPPPPPP 344 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTP--PXAXGGXXA 678 G G PPP GG PPPPPP P P A GG A Sbjct: 318 GTGVAPPPPPPPPPARPPGGAPPPPPPPPTSAPSAPPLPTASGGRSA 364 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP PP A + PPP Sbjct: 281 PPPPPPPGRPAAPPSAPPSAPSAPPP 306 >UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 1481 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPPPP P GG PPP G Sbjct: 1398 PPPPPAFSAAAPPPPPPPPPVGGAP----GGPPPPPPPAG 1433 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP 651 PPPP GG PPPPPP P Sbjct: 1412 PPPPPPVGGAPGGPPPPPPPAGDAP 1436 Score = 27.9 bits (59), Expect(2) = 2.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 P P G PPPPPPP Sbjct: 14 PGPTGFGQQQPPPPPPPP 31 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 613 PPPPPPPQ 636 PPPPPPPQ Sbjct: 27 PPPPPPPQ 34 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PP P PPPPPPP P GG PPP G Sbjct: 911 PPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPG 950 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P G PPPPPPP PP + G PPP Sbjct: 892 PPMPPVSAGPPLPPPPPPP--PPLPPPSSAGPPPPPPP 927 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPP------PPQXXXTPPXAXGGXXAXPPPXG 696 PPP G PPPPP PP PP A PPP G Sbjct: 914 PPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPG 958 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP------PQXXXTPPXAXGGXXAXPPPXGG 699 P PP G PPPPPP P PP A PPP G Sbjct: 912 PLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPG 958 >UniRef50_UPI0000E49E39 Cluster: PREDICTED: similar to Wiskott-Aldrich syndrome (eczema-thrombocytopenia); n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Wiskott-Aldrich syndrome (eczema-thrombocytopenia) - Strongylocentrotus purpuratus Length = 492 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 562 SQKKXPP-PPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 SQ PP PP PPPPPPP PP G PPP Sbjct: 338 SQYNAPPAPPPTRPMTSAPPPPPPPPSAPMPPPMNGSVPPPPPP 381 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP-----PPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP PP P G PPP Sbjct: 269 PPPPPPSRGSHAPPPPPSRTPGPPLPNRPPAPPPPGNSRGPPP 311 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP--PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PP PPP P PP PPP G Sbjct: 331 PPPPPPQSQYNAPPAPPPTRPMTSAPPPPPPPPSAPMPPPMNG 373 >UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 1167 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP----PPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPP P PP G A PPP GG Sbjct: 642 PPPPLPMGEQGAPPPPPSMGAPGVPPPPPPPPSGFGPAPPPPPGG 686 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 577 PPPPXXXG--GXXXPPPPPPPQXXXTPPXAXGGXXA 678 PPPP G G PPPPPP PP GG A Sbjct: 654 PPPPPSMGAPGVPPPPPPPPSGFGPAPPPPPGGQPA 689 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ---XXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P+ PP G A PPP Sbjct: 617 PPPPPLPMSADVPPPPPLPELSGIPPPPPLPMGEQGAPPPP 657 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P Q PP + G PPP Sbjct: 629 PPPPPLPELSGIPPPPPLPMGEQGAPPPPPSMGAPGVPPPP 669 >UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, periplasmic energy transduction protein TonB; n=1; Myxococcus xanthus DK 1622|Rep: Ferric siderophore transporter, periplasmic energy transduction protein TonB - Myxococcus xanthus (strain DK 1622) Length = 269 Score = 40.3 bits (90), Expect = 0.061 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP+ P A PPP Sbjct: 71 PPPPPVVEAKPPPPPPPPPKPKLAPKPAPPAAAKAPPP 108 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP G A PPP Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPP 564 Score = 39.9 bits (89), Expect = 0.081 Identities = 28/101 (27%), Positives = 30/101 (29%), Gaps = 6/101 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP----QXXXTPPXAXG--GXXAXPPPXGGXXXXXXXXXXXRQ 738 PPPP G PPPPPPP + PP G G PPP Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPP 609 Query: 739 QKKFXXXXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRPR 861 P R G PPPP RP+ Sbjct: 610 PPMAMANGAAGPPPPPPRMGMANGAAGPPPPPGAARSLRPK 650 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT--PPXAXGGXXAXPPP 690 PPPP PPPPPPP+ PP G A PPP Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 Q PPPP PPPPPPP PP PPP Sbjct: 204 QPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 40.3 bits (90), Expect = 0.061 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 232 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 242 PPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPP 279 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP + PPP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP +PP PPP Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP + PPP Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPP 268 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 241 PPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPP 278 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + + PPPP PPPPPPP PP PPP Sbjct: 202 EPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 243 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 255 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 243 PPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPP 280 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP +PP PP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + P P Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSP 271 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXP---PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPPP PP PPP Sbjct: 248 PPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPP 288 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPPP +PP PPP Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPP 277 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PPP PP + PPP Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 >UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza sativa|Rep: Putative formin I2I isoform - Oryza sativa subsp. japonica (Rice) Length = 881 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPPPPPP+ PP G PP Sbjct: 350 KLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 >UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms|Rep: Ah1644 protein - Drosophila melanogaster (Fruit fly) Length = 1644 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPP-----QXXXTPPXAXGGXXAXPPP 690 S K PPPP PPPPPPP PP GG PPP Sbjct: 266 SAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPP 313 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP GG PPPPPP + P Sbjct: 298 PPPPMINGGALPPPPPPPSMQMASRP 323 Score = 35.1 bits (77), Expect = 2.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPPP Sbjct: 297 PPPPPMINGGALPPPPPPP 315 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPPP 690 G S + P P PPPPPPP PP G PPP Sbjct: 249 GSDASSPTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPP 299 >UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c; n=1; Candida glabrata|Rep: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1039 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPPPP PP A PPP Sbjct: 668 PPPSDHSGPHGAPPPPPPPTHTAHPPPPPPTHAAHPPP 705 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP G PP Sbjct: 681 PPPPPPTHTAHPPPPPPTHAAHPPPPPPTAGHDGQAPP 718 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP G PPP Sbjct: 682 PPPPPTHTAHPPPPPPTHAAHPPPPPPTAGHDGQAPPP 719 >UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 1648 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S+ PP G PPPPPPP PP G PPP Sbjct: 970 SKTNGPPQAPGFNGPPPPPPPPPPMPGQGPPGFNGPPPPPPPP 1012 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S K PP PPPPPPP P G PPP Sbjct: 969 SSKTNGPPQAPGFNGPPPPPPPPPPMPGQGPPGFNGPPPPPPP 1011 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP G PPPPPPP GG PPP Sbjct: 999 PPGFNGPPPPPPPPPPPGMNAPVAPGFGGPPPPPPP 1034 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 7/52 (13%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGG-------XXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F PPPP G PPPPPPP P A G PPP Sbjct: 981 FNGPPPPPPPPPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPGFGGPPPPP 1032 >UniRef50_A6QTR5 Cluster: Adenylyl cyclase-associated protein; n=1; Ajellomyces capsulatus NAm1|Rep: Adenylyl cyclase-associated protein - Ajellomyces capsulatus NAm1 Length = 500 Score = 40.3 bits (90), Expect = 0.061 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 PPPP G PPPPPPP PP A Sbjct: 234 PPPPPTAGAGGPPPPPPPPAGGAAPPKA 261 Score = 35.9 bits (79), Expect = 1.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP G PPPPPPP P Sbjct: 233 PPPPPPTAGAGGPPPPPPPPAGGAAP 258 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 598 GGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G PPPPPPP PP A G PPP Sbjct: 225 GSTLPPPPPPPP-----PPTAGAGGPPPPPP 250 >UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2 - Homo sapiens (Human) Length = 1865 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1086 PPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPG 1126 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1119 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1159 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1130 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1170 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1141 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1181 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1152 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1192 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1163 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1203 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1174 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1214 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1185 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1225 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1196 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1236 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1207 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1247 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1229 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPG 1269 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1273 PPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPG 1313 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1218 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPG 1258 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1240 PPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1280 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P PP G PPP Sbjct: 1251 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPP 1288 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1295 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPG 1335 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1306 PPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPG 1346 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1317 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPG 1357 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP-PXAXGGXXAXPPPXGG 699 PPPP G PPPPP P P P G PPP G Sbjct: 1052 PPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPG 1093 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G P PP P PP G PPP G Sbjct: 1064 PPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPG 1104 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPP P PP G PPP G Sbjct: 1097 PPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1137 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P PP G PPPP P PP G PPP G Sbjct: 1108 PLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1148 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP PPP G Sbjct: 1262 PPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPG 1302 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPP P PP G PPP G Sbjct: 1284 PPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1324 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G P P Sbjct: 1328 PPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAP 1364 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP-PQXXXTPPXAXGGXXAXP-PPXGG 699 P PP G PPPPPP P PP G P PP G Sbjct: 1040 PQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPG 1082 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P P G PPPP P PP G PPP G Sbjct: 1076 PLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPG 1115 >UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV.; n=4; Xenopus tropicalis|Rep: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. - Xenopus tropicalis Length = 1182 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPPPXGG 699 PPPP G PPPPP P PP GG PPP G Sbjct: 667 PPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPPPPPFPG 710 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT-PPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G + PPP Sbjct: 643 PPPPPLPGSSSVPPPPPLPGISSAPPPPPLPGFSSVPPP 681 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G + PPP Sbjct: 631 PPPPLLPGFPSVPPPPPLPGSSSVPPPPPLPGISSAPPP 669 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT-PPXAXGGXXAXPPP 690 PPPP G PPPPP P PP + PPP Sbjct: 655 PPPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPP 693 >UniRef50_Q0S917 Cluster: Possible proline rich protein; n=1; Rhodococcus sp. RHA1|Rep: Possible proline rich protein - Rhodococcus sp. (strain RHA1) Length = 338 Score = 39.9 bits (89), Expect = 0.081 Identities = 25/58 (43%), Positives = 26/58 (44%), Gaps = 5/58 (8%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPP---PPPP--PQXXXTPPXAXGGXXAXPPPXGG 699 G G + Q PPPP GG PP PPPP P PP GG PPP GG Sbjct: 15 GDQGGYPPQGNPPPPP---GGYPPPPGNYPPPPQGPPPGGYPPPPPGGN--YPPPPGG 67 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/60 (35%), Positives = 22/60 (36%) Frame = -1 Query: 511 PXXXXFXPPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPP 332 P + PPP P P G P GG PPP G PPPP G PP Sbjct: 28 PPPGGYPPPPGNYPPPPQGPP------------PGGYPPPP----PGGNYPPPPGGNYPP 71 >UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein; n=1; Mycobacterium gilvum PYR-GCK|Rep: Integral membrane protein-like protein - Mycobacterium gilvum PYR-GCK Length = 335 Score = 39.9 bits (89), Expect = 0.081 Identities = 22/51 (43%), Positives = 23/51 (45%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GG Q PPPP GG PPPPP+ PP GG PPP G Sbjct: 8 GGYPPPPQGGYPPPPPSEGGY----PPPPPEGGYPPPPPAGG-YQQPPPGG 53 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 580 PPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP GG PP PPPPP PP G PPP GG Sbjct: 5 PPP---GGYPPPPQGGYPPPPPSEGGYPPPPPEGGYPPPPPAGG 45 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 580 PPPXXXGGXXXPPP-----PPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP GG PPP PPP PP GG PPP GG Sbjct: 38 PPPPPAGGYQQPPPGGAYPPPPGPGGYPPPPGQGG---YPPPPGG 79 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 8/48 (16%) Frame = +1 Query: 580 PPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXP----PPXGG 699 PPP GG PP PPPP PP GG P PP GG Sbjct: 56 PPPPGPGGYPPPPGQGGYPPPPGGYGMPPAGFGGGYPPPGQGYPPVGG 103 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPPXGGXPP 332 GG PPP G PPPPP GG PP Sbjct: 16 GGYPPPPPS--EGGYPPPPPEGGYPP 39 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + PPPP PPPPPPP +PP PPP Sbjct: 240 RPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S PPPP PPPPPPP P PPP Sbjct: 236 SPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP PP Sbjct: 258 PPPPPPPSPPPPPPPPPPPPPPLLPP 283 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP PP Sbjct: 261 PPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP--PPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPP PPPP +PP + PPP Sbjct: 205 PSPPPVTPAVRRPPPSSPPPPPSASSPPSSPSPSPRPPPP 244 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 S + PPP PPPPPPP PP PP Sbjct: 238 SPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 >UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class, expressed; n=4; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class, expressed - Oryza sativa subsp. japonica (Rice) Length = 675 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 PPPP PPPPPPP PP A G P Sbjct: 38 PPPPPTPSSPQRPPPPPPPATPPPPPPASPGKNQSP 73 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 A S PPPP PPPPPP PP + G + P Sbjct: 31 ASPSPSPPPPPPTPSSPQRPPPPPPPATPPPPPPASPGKNQSPASP 76 >UniRef50_Q6C6N4 Cluster: Similar to DEHA0F03828g Debaryomyces hansenii; n=1; Yarrowia lipolytica|Rep: Similar to DEHA0F03828g Debaryomyces hansenii - Yarrowia lipolytica (Candida lipolytica) Length = 600 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG-GXXAXPPPXGG 699 PPPP GG P PP PP PP G PPP GG Sbjct: 201 PPPPGGPGGLGGPAPPGPPGHHGGPPTHIGLPPLHHPPPPGG 242 >UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 307 Score = 39.9 bits (89), Expect = 0.081 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPP------QXXXTPPXAXGGXXAXPPP 690 SQ PPPP PPPPPPP Q PP A A PPP Sbjct: 80 SQAPPPPPPPPPTSTQAPPPPPPPPAETTTQAPPPPPPAETTTQAPPPP 128 >UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 429 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP G PPPPPPP PP A G A PPP Sbjct: 347 PPKTTGAPPPPPPPPPP----PPPPASSGSPAPPPP 378 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT 648 PPPP G PPPPPPP T Sbjct: 363 PPPPPASSGSPAPPPPPPPPPKTT 386 >UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - Mus musculus (Mouse) Length = 1567 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP A G PPP Sbjct: 1021 PPPPPLPGMGIPPPPPLPGSGIPPPPALPGVAIPPPP 1057 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 922 PPPPPLPGMGIPPPPPLPGMGIPPPPPLPGVGIPPPPPLPG 962 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 1021 PPPPPLPGMGIPPPPPLPGSGIPPPPALPGVAIPPPPPLPG 1061 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 933 PPPPPLPGMGIPPPPPLPGVGIPPPPPLPGVGIPPPP 969 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 944 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 980 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 955 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 991 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 966 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1002 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 977 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1013 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 988 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 1024 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 999 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGMGIPPPP 1035 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 1010 PPPPPLPGVGIPPPPPLPGMGIPPPPPLPGSGIPPPP 1046 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP G PPP Sbjct: 910 PPPAPPLPGMGIPPPPPLPGMGIPPPPPLPGMGIPPPP 947 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 933 PPPPPLPGMGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPG 973 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 944 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPG 984 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 955 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPG 995 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 966 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPG 1006 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 977 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPG 1017 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 988 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPG 1028 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP G Sbjct: 999 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGMGIPPPPPLPG 1039 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PP G Sbjct: 1010 PPPPPLPGVGIPPPPPLPGMGIPPPPPLPGSGIPPPPALPG 1050 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP P G PPPP P PP G PPP G Sbjct: 911 PPAPPLPGMGIPPPPPLPGMGIPPPPPLPGMGIPPPPPLPG 951 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP PPP Sbjct: 1043 PPPPALPGVAIPPPPPLPGMGVPPPAPPPPGAGIPPP 1079 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP G PP PPPP PP G + PP Sbjct: 1054 PPPPPLPGMGVPPPAPPPPGAGIPPPPLLPG--SGPP 1088 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P P G PPP Sbjct: 1043 PPPPALPGVAIPPPPPLPGMGVPPPAPPPPGAGIPPPP 1080 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP----QXXXTPPXAXGGXXAXPPPXGG 699 PP P G PPPPP P PP G PPP G Sbjct: 896 PPQPPPLPGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPPPPPLPG 940 >UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 9.t00033 - Entamoeba histolytica HM-1:IMSS Length = 540 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ------XXXTPPXAXG-GXXAXPPP 690 PPPP G PPPPPPP PP A G G A PPP Sbjct: 386 PPPPARGTGCGAPPPPPPPAFDTGCGIPPPPPPARGTGCGAPPPP 430 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP-PQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP A G PPP Sbjct: 415 PPPPARGTGCGAPPPPPPLNAPPPPPPPAHGTGCGVPPP 453 Score = 39.1 bits (87), Expect = 0.14 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ------XXXTPPXAXG-GXXAXPPP 690 PPPP GG PPPPPP PP A G G A PPP Sbjct: 357 PPPPPSYGGHHNVPPPPPPAFDTGCGVPPPPPPARGTGCGAPPPP 401 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 AF + PPPP G PPPPP PP G PPP Sbjct: 376 AFDTGCGVPPPPPPARGTGCGAPPPPP-----PPAFDTGCGIPPPP 416 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP-PPXG 696 S PPPP PPPPPPP +PP A P PP G Sbjct: 201 SASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFG 246 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PP PPPP +PP + PP Sbjct: 99 PPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP P A PPP Sbjct: 132 PPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPP 169 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPP PP +PP + PPP Sbjct: 70 PSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPP 107 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +1 Query: 547 GGAFXSQKKXPPP--PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GGA+ + PPP P PPP PPP +PP + PPP Sbjct: 13 GGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPP-PPSPPPSPPPP 61 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPP PP PP + PPP Sbjct: 60 PPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPP 97 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP +PP + PPP Sbjct: 82 PPPPSPPSPPPSPPPPSPP--PPSPPPPSPPPPSPPPP 117 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P P PPP +PP PPP Sbjct: 219 PPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPP 256 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GGGA + PPP PPPPPPP P A PPP Sbjct: 260 GGGAEAAVVDVAPPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPP 308 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GGG PPPP PPPPPPP P PPP Sbjct: 260 GGGAEAAVVDVAPPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPP 309 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG A PPPP PPPPPPP P PPP Sbjct: 261 GGAEAAVVDVAPPPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPP 310 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PP PP A PPP Sbjct: 277 PPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPP 314 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PP P PP A PPP Sbjct: 278 PPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPP 315 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 +F PPPP PPPPPPP PP + PPP Sbjct: 371 SFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S PPPP PPPPPPP PP PPP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP P + PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP +PP PPP Sbjct: 655 PPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP + PPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 656 PPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP PP A PP Sbjct: 682 PPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPP 246 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP PP PP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPP 251 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP PPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP P P Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P + PPP Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P PPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P PPP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPP 701 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP PP PPP Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP + PP Sbjct: 681 PPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 659 PPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPP 261 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP PPP Sbjct: 674 PLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PP Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 >UniRef50_Q6PSU8 Cluster: Formin homology 2 domain-containing protein 5; n=4; Arabidopsis thaliana|Rep: Formin homology 2 domain-containing protein 5 - Arabidopsis thaliana (Mouse-ear cress) Length = 900 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PP P G PPPPP P+ PP G A PP G Sbjct: 390 PPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSG 429 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 PP P G PPP PPP PP G PPP Sbjct: 377 PPMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 230 PPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPP PP + PPP Sbjct: 203 KYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPP 242 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + K PPPP PP PPPP PP PPP Sbjct: 201 ASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPP 243 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP +PP PP Sbjct: 227 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPP 263 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S+ PPPP P PPPPP PP PPP Sbjct: 202 SKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPP 244 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPP 246 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP + PPP Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP PPP Sbjct: 218 PPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP + + PPP Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 210 PPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP + P P Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLP 265 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP + PP Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPP 266 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 S P PP PPPPPPP PP PP Sbjct: 214 SPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PPP Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPP 245 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PPP PP + PPP Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PP PPPP PP PPP Sbjct: 212 PPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 249 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP +PP PP Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 252 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 39.5 bits (88), Expect = 0.11 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 8/61 (13%) Frame = +1 Query: 541 GGGGAFXSQKKXPPP-----PXXXGGXXXPPPPPPPQXXXTPPXAXG---GXXAXPPPXG 696 GG G PPP P GG PPPPPPP PP G PPP Sbjct: 634 GGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPPRMGNGPPPPPGK 693 Query: 697 G 699 G Sbjct: 694 G 694 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPP-PPPQXXXTPPXAXGGXXAXPPP 690 GG A + PPPP G PP PPP PP G PPP Sbjct: 618 GGSASSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPP 667 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K+ PPPP PPPPPP PP G P Sbjct: 661 KQPPPPPPPPPPPPPPPPPPPRMGNGPPPPPGKGASGAAAP 701 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXG-----GXXAXPPPXG 696 PPPPPPP T P A G G PPP G Sbjct: 582 PPPPPPPASSATAPTAVGPAPPPGLPPPPPPPG 614 >UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1164 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPPP GG PPPPPPP PP GG Sbjct: 580 PPPPGFPGGA--PPPPPPPFGAPPPPALNGG 608 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPPP G PPPPPP PP A G Sbjct: 577 PPPPPPPGFPGGAPPPPPPPFGAPPPPALNG 607 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -1 Query: 415 FXGGXPPPXXXFFXXGXPPPPPXGGXPPXXF 323 F GG PPP F G PPPP G PP + Sbjct: 585 FPGGAPPPPPPPF--GAPPPPALNGGPPREY 613 >UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 664 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG + PPPP G PPPPP PP A PPP Sbjct: 421 GGTPAAGGPPPPPPPRDGATPLSRPPPPPSRSAIPPPAAAPTAYTPPP 468 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Frame = +1 Query: 577 PPPPXXXGGXXXP------PPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP P PPPPPP P A GG PPP G Sbjct: 486 PPPPPPASSRPVPGVPGGVPPPPPPPPPGPGPAAAGGPPPPPPPPPG 532 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXG--GXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP P G A PPP G Sbjct: 509 PPPPPGPGPAAAGGPPPPPPPPPGAAPSF---GSAAPPPPPG 547 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXG-----GXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 G G + PPPP G G PPPPP P PP GG PPP G Sbjct: 514 GPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGP-----PPAMSGGPPPPPPPPG 564 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 + PPPP G PPP P TP A GG PPP G Sbjct: 397 RSVPPPPELPGRAVPAPPPSLPARGGTP--AAGGPPPPPPPRDG 438 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG PPPP PPPPP + PP A PPP Sbjct: 421 GGTPAAGGPPPPPPPRDGATPLSRPPPPPSRSAIPPPAAAPTAYTPPPP 469 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 6/44 (13%) Frame = +1 Query: 577 PPPPXXXG------GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P GG PPP Sbjct: 467 PPPPAAASPAAAQSSYTPPPPPPPPASSRPVPGVPGGVPPPPPP 510 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 G +F S PPP PPPPPP PP G PPP G Sbjct: 532 GAAPSFGSAAPPPPPGPPPAMSGGPPPPPP------PPGDFGVTPGPPPPPTG 578 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP P GG PPP Sbjct: 982 PPPPPPLPGFSGPPPPPPPPL----PGFSGGPPPPPPP 1015 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 F PPPP PPPPPPP P + G PPP G Sbjct: 991 FSGPPPPPPPPLPGFSGGPPPPPPPP----LPGFSGGAPPPPPPPMPG 1034 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PP P GG PPPPP P PP Sbjct: 1015 PPLPGFSGGAPPPPPPPMPGAPIPPP 1040 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPPPP PP G PPP G Sbjct: 4 PPPPPPP----PPPPPPPPPPLGAPPPPPLGAPPPPPPPG 39 >UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1331 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G A PPP Sbjct: 800 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPP 838 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPP 690 S PPPP G PPPPP P TPP G PPP Sbjct: 748 STSAPPPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPP 791 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP + PPP Sbjct: 788 PPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPP 825 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P PP G PPP Sbjct: 825 PPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPP 862 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P PP G A PPP Sbjct: 813 PPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPP 850 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP PPP Sbjct: 824 PPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPP 861 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPP P PP G A PPP Sbjct: 765 PPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPP 802 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPPP Sbjct: 847 PPPPPPLPGMGVPPPPPPP 865 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP G PPPPP P PP + PPP Sbjct: 776 PTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPP 813 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP----QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G PPP Sbjct: 836 PPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPPPP 877 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG-----GXXAXPPP 690 PPPP PPPPPPP P A G + PPP Sbjct: 861 PPPPPLTHTGPAPPPPPPPIPPSMAPGACAPPLAFGFGSLPPP 903 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP PP PPP G Sbjct: 823 PPPPPPLPGMGAPPPPPPLPGLSAPPP--------PPPLPG 855 >UniRef50_UPI0000E464D4 Cluster: PREDICTED: similar to ENSANGP00000006560; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ENSANGP00000006560 - Strongylocentrotus purpuratus Length = 525 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPP PP A A PPP Sbjct: 383 PPPPPPVGGPAA-PPPPPIGGIQKPPVANNNVPAPPPP 419 Score = 28.3 bits (60), Expect(2) = 0.93 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPP 633 SQ++ P PP PPPPPP Sbjct: 302 SQQQLPQPPPMNHHVPTMPPPPPP 325 Score = 27.1 bits (57), Expect(2) = 0.93 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPPQ P A PPP Sbjct: 348 PPPPPPPQ----PIMMNNYAPAQPPP 369 >UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n=2; Danio rerio|Rep: UPI00015A5D5E UniRef100 entry - Danio rerio Length = 1093 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G A PPP Sbjct: 873 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPP 911 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPP 690 S PPPP G PPPPP P TPP G PPP Sbjct: 821 STSAPPPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPP 864 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP + PPP Sbjct: 861 PPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPP 898 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P PP G PPP Sbjct: 898 PPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPP 935 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P PP G A PPP Sbjct: 886 PPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPP 923 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP PPP Sbjct: 897 PPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPP 934 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPP P PP G A PPP Sbjct: 838 PPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPP 875 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPPP Sbjct: 920 PPPPPPLPGMGVPPPPPPP 938 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP G PPPPP P PP + PPP Sbjct: 849 PTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPP 886 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP----QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G PPP Sbjct: 909 PPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPPPP 950 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG-----GXXAXPPP 690 PPPP PPPPPPP P A G + PPP Sbjct: 934 PPPPPLTHTGPAPPPPPPPIPPSMAPGACAPPLAFGFGSLPPP 976 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP PP PPP G Sbjct: 896 PPPPPPLPGMGAPPPPPPLPGLSAPPP--------PPPLPG 928 >UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: Enabled homolog - Rattus norvegicus (Rat) Length = 526 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP A P P G Sbjct: 293 PPPPLPSAGPPPPPPPPPPLPNQVPPPPP-PPPAPPLPASG 332 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP PP G PPP Sbjct: 271 PPPPLPSGPAYASALPPPPGPPPPPPLPSAGPPPPPPP 308 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 291 PPPPPPLPSAGPPPPPPPP-----PPLPNQVPPPPPPP 323 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPP PP PP PPP G Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPG 535 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG PPPP PPPPPP PP PPP Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPP P PP PPP G Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPG 535 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP PP G P Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G F S + PPP PPPPPPP PP PPP Sbjct: 4 GNSEFVSFWRVDPPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 >UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG21491; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG21491 - Caenorhabditis briggsae Length = 429 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPQ +PP + PP G Sbjct: 316 PPPPPSGAPPTGSPPPPPPQSGGSPPPGAPPSGSPPPRPSG 356 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP--PP---PPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PP PP PPP+ PP PPP Sbjct: 329 PPPPPPQSGGSPPPGAPPSGSPPPRPSGAPPAGGSPPTGSPPP 371 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXT--PPXAXGGXXAXPPP 690 PPP G PPPPPP T PP PPP Sbjct: 304 PPPRPSGAPGSPPPPPPSGAPPTGSPPPPPPQSGGSPPP 342 >UniRef50_Q54TI7 Cluster: WH2 domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: WH2 domain-containing protein - Dictyostelium discoideum AX4 Length = 459 Score = 39.1 bits (87), Expect = 0.14 Identities = 24/61 (39%), Positives = 26/61 (42%), Gaps = 10/61 (16%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPP-----PPQ--XXXTPPXAXGG---XXAXPPPX 693 GGG PPPP GG PPPP PPQ PP + GG + PPP Sbjct: 328 GGGPTQPPMNRPPPPGPNGGPMNRPPPPGPNGGPPQPMNRPPPPGSNGGPPQPMSRPPPP 387 Query: 694 G 696 G Sbjct: 388 G 388 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 SQ + PPP G PP PP PP GG PP Sbjct: 259 SQIQNRPPPVPTGNSPQRPPTQPPMNRPPPPGPNGGGPPQPP 300 Score = 35.5 bits (78), Expect = 1.7 Identities = 26/92 (28%), Positives = 28/92 (30%), Gaps = 4/92 (4%) Frame = +1 Query: 571 KXPPPPXXXGGXXXP----PPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQ 738 + PPP GG P PPPP P PP + PPP G R Sbjct: 285 RPPPPGPNGGGPPQPPISRPPPPNPGGPPQPPIS-----RPPPPNPGTGGGPTQPPMNRP 339 Query: 739 QKKFXXXXXHRXXPXXGRXGGGXXXXXAPPPP 834 P G GG PPPP Sbjct: 340 PPPGPNGGPMNRPPPPGPNGGPPQPMNRPPPP 371 Score = 35.1 bits (77), Expect = 2.3 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 13/64 (20%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXP---PPPP----------PPQXXXTPPXAXGGXXAXP 684 GGG PPPP G P PPPP PP PP GG P Sbjct: 293 GGGPPQPPISRPPPPNPGGPPQPPISRPPPPNPGTGGGPTQPPMNRPPPPGPNGGPMNRP 352 Query: 685 PPXG 696 PP G Sbjct: 353 PPPG 356 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 6/59 (10%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGG----XXXPPPPPPPQXXXTPPXAXGGXXAXPP--PXGG 699 G G PPPP GG PPPP P P G PP P GG Sbjct: 356 GPNGGPPQPMNRPPPPGSNGGPPQPMSRPPPPGQPNMPPRPVSTINGVGGAPPTQPNGG 414 >UniRef50_Q23248 Cluster: Putative uncharacterized protein grl-21; n=2; Caenorhabditis|Rep: Putative uncharacterized protein grl-21 - Caenorhabditis elegans Length = 172 Score = 39.1 bits (87), Expect = 0.14 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 PPPP GG PPPPPPP P A Sbjct: 42 PPPPPCGGGYEAPPPPPPPSYAGGPSYA 69 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPPP P A G A P G Sbjct: 41 PPPPPPCGGGYEAPPPPPP-----PSYAGGPSYAGPSYAG 75 >UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 866 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPP PP G PPP G Sbjct: 85 PPPPMFAGGI--PPPPPMMGGIPPPPPMFGAPPPPPPPSG 122 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPPXGGXPPXXFFFFSP 308 GG PPP F PPPP GG PP F +P Sbjct: 81 GGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAP 114 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPP P PP GG PP GG Sbjct: 66 PPPVPNG--FIPPPPGPGGIPPPPPMFAGGIPPPPPMMGG 103 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -1 Query: 511 PXXXXFXPPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPP 332 P F PPP P P GG PPP F PPPP G P Sbjct: 68 PVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMMGGIPPPPPMFGAPPPPPPPSGLGVAP 127 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPP PP G P P Sbjct: 95 PPPPPMMGGI---PPPPPMFGAPPPPPPPSGLGVAPQP 129 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP GG PPPPP PP G PPP G Sbjct: 75 PPPPGPGGI--PPPPPMFAGGIPPPPPMMGGIPPPPPMFG 112 >UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_34, whole genome shotgun sequence - Paramecium tetraurelia Length = 1131 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAX--PPPXG 696 PPPP GG PPPPPP PP A G PPP G Sbjct: 636 PPPPPPPGGKTGAPPPPPP-----PPGAKAGGPPPPPPPPGG 672 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPP T A PPP GG Sbjct: 604 PPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGG 644 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP PP PPP GG Sbjct: 639 PPPPGGKTGAPPPPPPPPGAKAGGPP-------PPPPPPGG 672 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 GG + PPPP G PPPPPPP PP Sbjct: 643 GGKTGAPPPPPPPPGAKAGG--PPPPPPPPGGKAPP 676 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPP P G PPP G Sbjct: 618 PPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPPG 657 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP PP A PPP Sbjct: 594 PPPPPPPPPPPPPPSAKSQVPPPPPP 619 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 PPPP G PPPPPP P A P Sbjct: 650 PPPPPPPGAKAGGPPPPPPPPGGKAPPLPNAKPAVP 685 >UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 1083 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP P GG PPP Sbjct: 592 PPPPVQQTGTSLPPPPPPP-----PIQTTGGPPPPPPP 624 >UniRef50_A0CJV0 Cluster: Chromosome undetermined scaffold_2, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_2, whole genome shotgun sequence - Paramecium tetraurelia Length = 362 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPP Q PP PPP G Sbjct: 211 PPPPPMQQGYVPPPPPPMQQGYVPPPPPMQQGYVPPPPPPG 251 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP Q PP G P P Sbjct: 222 PPPPPPMQQGYVPPPPPMQQGYVPPPPPPGQQPYTPYP 259 >UniRef50_A0CFX0 Cluster: Chromosome undetermined scaffold_177, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_177, whole genome shotgun sequence - Paramecium tetraurelia Length = 1328 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP G P PPPPP P GG PPP G Sbjct: 806 PPPLGAKTGASSPAPPPPPGGPKPPGPPPGGAPPPPPPPG 845 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP P PPPP PP G PPP G Sbjct: 805 PPPPLGAKTGASSPAPPPPPGGPKPPGPPPGGAPPPPPPPG 845 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXT------PPXAXGGXXAXPPPXGG 699 SQ PPPP PPPPP T PP GG PP GG Sbjct: 785 SQVPPPPPPPGTISVSALAPPPPPLGAKTGASSPAPPPPPGGPKPPGPPPGG 836 >UniRef50_Q7SFQ1 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 283 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP + GG A PPP Sbjct: 106 PPPPPPPASSGSPPPPPQSS---VPPASSGGPSAPPPP 140 >UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa group|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 309 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S PPPP PPPPPPP T P PPP Sbjct: 243 SHTPAPPPPPPPPSSSLPPPPPPPPPSSTRPPPPPPAQTTPPP 285 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S PPPP PPPPP PP PPP Sbjct: 234 SHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPPPSSTRPPPP 276 >UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2; Mus musculus|Rep: FH1/FH2 domain-containing protein 1 - Mus musculus (Mouse) Length = 1197 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP A G PPP Sbjct: 591 PPPPPPITGSCPPPPPPP-----LPPPATGSCPPPPPP 623 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 586 PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P GG PPPPPPP PP PPP G Sbjct: 581 PSLSGGPPPPPPPPPPITGSCPPPP---PPPLPPPATG 615 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 Q + PPP PPPPPPP PP PPP Sbjct: 229 QVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P PPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPPPPP +PP + PPP Sbjct: 88 KVPPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPP 127 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 K PPPP PPPPP P PP + PP Sbjct: 88 KVPPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPP 127 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP +PP + PPP Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 132 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 94 PPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 131 >UniRef50_O23374 Cluster: P140mDia like protein; n=2; Arabidopsis thaliana|Rep: P140mDia like protein - Arabidopsis thaliana (Mouse-ear cress) Length = 645 Score = 38.7 bits (86), Expect = 0.19 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 + PPPP PPPPPPP+ PP PP Sbjct: 307 RSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 346 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP PPPPPP PP PP G Sbjct: 310 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKG 348 >UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 324 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PP PPPP PP A PPP G Sbjct: 34 PPPPPGPPGPPGPPGPPPPSWHHPPPP---DPFAPPPPPG 70 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = +1 Query: 577 PPPPXXXG--GXXXPPPP----PPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G G PPPP PPP PP G PPP G Sbjct: 35 PPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPPPPPG--PPGPPPPG 78 >UniRef50_A4RU08 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 150 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 5/58 (8%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXX-----GGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 GG G ++ PPPP G PPPPPPP A G PPP G Sbjct: 74 GGRGETEEEEAPPPPPPGEPPTEWGAGRAPPPPPPPPPPSGIGFAPMGAVDVPPPPSG 131 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP PPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP PPP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP PPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP PPP Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 >UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 576 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXP---PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG P PPPPPP PP G A PPP Sbjct: 368 PPPPPPPGGLRPPGKAPPPPPP----PPPMFAGKMKAPPPP 404 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P P GG PPPPPPP PP A PPP Sbjct: 517 PAPPQKGGVPPPPPPPPP-PKAPPPKGPPPKVAPPPP 552 >UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cerevisiae PAN1 protein; n=2; cellular organisms|Rep: Similar to sp|P32521 Saccharomyces cerevisiae PAN1 protein - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 1449 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 577 PPP---PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP P PPPPPPP TPP PPP G Sbjct: 1331 PPPSNIPPLPNTSAPPPPPPPPPPMDTPPIPSSSAPPPPPPPPG 1374 >UniRef50_Q0UQG7 Cluster: Adenylyl cyclase-associated protein; n=3; Pezizomycotina|Rep: Adenylyl cyclase-associated protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 546 Score = 38.7 bits (86), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 PPPP GG PP PPPP PP A Sbjct: 284 PPPPPPAGGIPPPPGPPPPPGPPPPPGA 311 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPPPPP PP PPP G Sbjct: 283 PPPPPPPAGGIPPPPGPPPPPGPPPPPG 310 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 >UniRef50_P41484 Cluster: Proline-rich antigen; n=21; Mycobacterium|Rep: Proline-rich antigen - Mycobacterium leprae Length = 249 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP PPPPPP PP GG PPP G Sbjct: 39 PPPTAPPVGGSYPPPPPPGGSYPPPPPPGGSYPPPPPSTG 78 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP GG PPPPPP PP + G A PPP Sbjct: 51 PPPPPPGGSY-PPPPPPGGSYPPPPPSTGA-YAPPPP 85 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 586 PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P G PP PP PP GG PPP GG Sbjct: 31 PSELGSAYPPPTAPPVGGSYPPPPPPGGSYPPPPPPGG 68 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F + PPP PPPPPPP PP PPP Sbjct: 51 FVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ 636 PPPP PPPPPPPQ Sbjct: 82 PPPPPPPSPPPPPPPPPPPQ 101 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP P P Sbjct: 75 PPPPPPPPPPPPPPSPPPPPPPPPPPQRRDAWTQEPSP 112 >UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Saccharomycetaceae|Rep: Branchpoint-bridging protein - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 518 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP------PPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPP PPP PP G PPP G Sbjct: 435 PPPPPPPSSLAPPPPPSSDIAPPPPSSDRAPPPPPSGIAPPPPPSG 480 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP A PPP Sbjct: 425 PPPPPPSS--LAPPPPPPPS-SLAPPPPPSSDIAPPPP 459 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP-----PPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPP PPPP PP PPP G Sbjct: 427 PPPPSSLAPPPPPPPSSLAPPPPPSSDIAPPPPSSDRAPPPPPSG 471 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S + PPPP PPPPP PP + G PPP Sbjct: 461 SDRAPPPPPSGIA-----PPPPPSGIAPPPPKSPNGVAPPPPP 498 >UniRef50_UPI0000EB21A1 Cluster: ABI gene family member 3 (New molecule including SH3) (Nesh).; n=1; Canis lupus familiaris|Rep: ABI gene family member 3 (New molecule including SH3) (Nesh). - Canis familiaris Length = 486 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/49 (38%), Positives = 23/49 (46%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GGG+ + PPPP G PPPPP P+ PP + PPP Sbjct: 335 GGGSTTKGQAAPPPPPLPG--MAPPPPPAPEVFLPPPPLE--EVSLPPP 379 >UniRef50_Q4TB92 Cluster: Chromosome undetermined SCAF7174, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF7174, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1185 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 P PP PPPPPPP+ PP A A PP Sbjct: 730 PSPPRKSTRSPSPPPPPPPKPAVKPPKAPPAVVADPP 766 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F S PPPP PPPP PP PP PPP Sbjct: 202 FPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPP 246 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP +PP + PPP Sbjct: 2693 PPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPP 2730 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G F PPPP PPPP PP PP PPP Sbjct: 1165 GKYFSCNPPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPP 1212 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP PP + PPP Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPP 247 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP PP PPP Sbjct: 217 PPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPP 254 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP +PP PPP Sbjct: 220 PPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 221 PPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P PPP Sbjct: 219 PPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXP-PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPPP +PP + PPP Sbjct: 2272 PPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPP 2310 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPP PPP PPP +PP + PPP Sbjct: 2666 KPPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPP 2706 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P A + PPP Sbjct: 2737 PPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPP 2774 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ-XXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP TPP + PPP Sbjct: 2257 PPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPP 2295 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP +PP + PPP Sbjct: 2708 PPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2745 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP P PPP Sbjct: 2277 PPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPP 2314 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP +PP + PPP Sbjct: 2545 PPPPLPPPPSPPPPSPPPPSPPPSPP-PPSPPPSPPPP 2581 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP P + PPP Sbjct: 218 PPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPP 255 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPP PP PP PPP Sbjct: 222 PPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPP 259 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPP +PP + PPP Sbjct: 2698 PPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPP 2735 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP +PP + PPP Sbjct: 2703 PPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2740 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 2717 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2754 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 2722 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2759 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F ++ PP P PPPP P PP PPP Sbjct: 2247 FYNENSPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPP 2291 >UniRef50_Q9L252 Cluster: Putative uncharacterized protein SCO2669; n=1; Streptomyces coelicolor|Rep: Putative uncharacterized protein SCO2669 - Streptomyces coelicolor Length = 604 Score = 38.3 bits (85), Expect = 0.25 Identities = 24/83 (28%), Positives = 27/83 (32%), Gaps = 1/83 (1%) Frame = +1 Query: 451 GXXGXXGXXKXGGXKXXXXXGXXFFFXXXXGGGG-AFXSQKKXPPPPXXXGGXXXPPPPP 627 G G G GG G + G GG + + PP P G P PP Sbjct: 302 GPGGYNGPGGPGGPNGPNNPGGPGGYNGPGGPGGPSGPNGPSGPPAPPGFGSDPSRPVPP 361 Query: 628 PPQXXXTPPXAXGGXXAXPPPXG 696 PP PP GG P G Sbjct: 362 PPGPVPPPPGGAGGPGGPGGPGG 384 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXP 600 PP GGG PP GG GGG GGG P Sbjct: 34 PPPGGGYGFPPPAGPGGPGGP-GGGPGGGPGGP 65 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 +F S PPPP PPPPPPP PP A Sbjct: 302 SFASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPA 337 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 306 PPPPP-------PPPPPPPPPPPPPPPPPPPPPPPPPP 336 >UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas neptunium ATCC 15444|Rep: OmpA family protein - Hyphomonas neptunium (strain ATCC 15444) Length = 387 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 PPPP PPPPPPP TPP A Sbjct: 240 PPPPPPPPPPPPPPPPPPPPEETTPPLA 267 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP PP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPP 259 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP T P Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPEETTP 264 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTP 651 +F + PPPP PPPPPPP P Sbjct: 227 SFAAPPAPPPPPPPPPPPPPPPPPPPPPPPPPP 259 >UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis thaliana|Rep: F23H11.22 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 929 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G F + P PP PPPPPP PP A PPP Sbjct: 364 GQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPP 410 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAX--GGXXAXPPP 690 PPPP PPPPPP + PP G A PPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP 423 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP + PP P P G Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPG 437 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP + PP PP G Sbjct: 397 PPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPG 437 >UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa0079B05.10; n=4; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0079B05.10 - Oryza sativa (Rice) Length = 1269 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G P PPPPP PP G PPP G Sbjct: 750 PPPPPLMTGKKAPAPPPPPPQAPKPP----GTVPPPPPLHG 786 Score = 36.3 bits (80), Expect = 1.00 Identities = 25/91 (27%), Positives = 26/91 (28%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQ 741 SQ PPPP P PPPPP PP PPP Sbjct: 583 SQPPPPPPPPPLPNCLVPSPPPPP----PPPPILPNRSVPPPPPPPPPLPNHSVLPPPPP 638 Query: 742 KKFXXXXXHRXXPXXGRXGGGXXXXXAPPPP 834 +R P G G PPPP Sbjct: 639 PPPPPSLPNRLVPPPPAPGIGNKFPAPPPPP 669 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P + PPP Sbjct: 551 PPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPP 588 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S +K P P PPPPPPP P + PPP Sbjct: 530 SDRKLPSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPP 572 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXX---PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP P PPP Sbjct: 549 PPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPP 589 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXP----PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G P PPPPP TP A PPP Sbjct: 651 PPPPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSSKGPPPP 692 >UniRef50_Q9GYL4 Cluster: Putative uncharacterized protein R04E5.8; n=2; Caenorhabditis elegans|Rep: Putative uncharacterized protein R04E5.8 - Caenorhabditis elegans Length = 997 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPP G PPPPPPP+ TPP Sbjct: 126 PPPRKSRAGGSSPPPPPPPRVPRTPP 151 >UniRef50_Q5TV67 Cluster: ENSANGP00000026333; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000026333 - Anopheles gambiae str. PEST Length = 389 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/46 (43%), Positives = 22/46 (47%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 GG+F SQ PPP PPPPPPP T P + G A P Sbjct: 229 GGSFLSQLPAIPPP--------PPPPPPPPAPSTQPPSSGSSGAQP 266 >UniRef50_Q23G58 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 385 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPP-----PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP P GG PPPPPP PP + G PPP Sbjct: 274 PPPLSLGLPGVPGGSSLPPPPPPNMSLPPPPISAPGGLPIPPP 316 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G F + PPPP G PPPP P GG PPP Sbjct: 248 GIFVNNNAPPPPPSLPGIVVNANAPPPPPLSLGLPGVPGGSSLPPPP 294 >UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|Rep: Formin 1,2/cappuccino - Aedes aegypti (Yellowfever mosquito) Length = 891 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP GG PP PPPP P G A PPP Sbjct: 349 PPSTSGGPPAPPLPPPPPPPTAPLAVGSGPPAPPPP 384 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F + P PP PPPPPP PP GG A P P Sbjct: 318 FKTAVAPPGPPPLPPPPPPPPPPPPISSVSIPPSTSGGPPAPPLP 362 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + + PPPP P PPPPP T G PPP Sbjct: 293 EAETPPPPPLPPPLPPPHPPPPPPMFKTAVAPPGPPPLPPPP 334 >UniRef50_A2F9Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 214 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPPXG 696 Q PPPP G PPPPPPP PP A PP G Sbjct: 101 QAGVPPPPAADGAPAPPPPPPPPGAGADGQAPPPPPPPDGAAPPAEG 147 >UniRef50_Q2HGM6 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 238 Score = 38.3 bits (85), Expect = 0.25 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 8/66 (12%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGG-----VXXXWGG---GGGGGXXXPPXXXGGGGXFFXXKKAPPP 543 PP GGG A PP A GG GG GG GG P G GG AP P Sbjct: 49 PPGGGGNAGNPPPAPGGGGNGRPPAPGGGNPTGGNGGGAPPAPGIGNGGGAPDPAGAPGP 108 Query: 542 PXXXXK 525 P K Sbjct: 109 PGGGGK 114 Score = 37.9 bits (84), Expect = 0.33 Identities = 32/119 (26%), Positives = 33/119 (27%) Frame = +1 Query: 334 GGXPPXGGGGGXPXKKXXXXGGXPPXKKXXXKXLXXXKKGXXGXXGXXKXGGXKXXXXXG 513 GG G G + PP G G G K GG G Sbjct: 111 GGGKGGGNGNAGAPPEPPPAPAPPPGAPPAPNGGGGIPGGRPGMPGMGKGGGGIPAGKGG 170 Query: 514 XXFFFXXXXGGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G GG P PP G PPP PPP P A G PPP Sbjct: 171 IMPGMGGIPGSGGGM------PMPPGPPPGPPGPPPGPPPPIPMGP--APGPSPKPPPP 221 Score = 34.7 bits (76), Expect = 3.0 Identities = 25/97 (25%), Positives = 27/97 (27%) Frame = +3 Query: 294 TPXXPGEKKKKXXGGXPPXGGGGGXPXXKXXXXGGGXPPXKXXXKKXXXXXKGXPXGXXG 473 +P P + G P GG G P G G PP G P G Sbjct: 34 SPPHPKRNHRFSPGNPPGGGGNAGNPPPAPGGGGNGRPPAPGGGNPTGGNGGGAPPA-PG 92 Query: 474 XXXGGGKXXXXXGRXFFFXXXXGGGGGFFXXKKXPPP 584 GGG GGG G PPP Sbjct: 93 IGNGGGAPDPAGAPGPPGGGGKGGGNGNAGAPPEPPP 129 >UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 592 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP GG PPPPPP P A PPP Sbjct: 215 PPPSNPPGGNLRAPPPPPPPPAAPPRPVPEAAPAPPPP 252 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP PP PPP Sbjct: 214 PPPPSNPPGGNLRAPPPPPPPPAAPPRPVPEAAPAPPP 251 >UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1373 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP-PPXGG 699 PPPP G PPPPPP PP G P PP GG Sbjct: 1293 PPPPMPSAGAPGGPPPPPP----PPPPGMGAPPPPPMPPMGG 1330 >UniRef50_A5E6V9 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 735 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGG 669 GGGA PPPP G P PPPPP P + GG Sbjct: 600 GGGAVPPPPPPPPPPAMSTGSAPPAPPPPPTMSTGAAPMSNGG 642 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +1 Query: 562 SQKKXPPPPXXX----GGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 SQ PPPP GG PPPPPPP P + G PPP Sbjct: 584 SQSAPPPPPLPQSMSAGGGAVPPPPPPP---PPPAMSTGSAPPAPPP 627 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G A S+ PPPP G P PPP+ P GG PPP Sbjct: 420 GPPAPPSRGGAPPPPPRAGMSNSGSPAPPPRNAGLTPMKTGGAGPPPPP 468 >UniRef50_Q96T25 Cluster: Zinc finger protein ZIC 5; n=16; Theria|Rep: Zinc finger protein ZIC 5 - Homo sapiens (Human) Length = 639 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/52 (38%), Positives = 22/52 (42%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 GGG+ +Q PPPP PPPPPP PP A G GG Sbjct: 115 GGGSSGAQPSAPPPPAPPLPPTPSPPPPPP---PPPPPALSGYTTTNSGGGG 163 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPPP PP A P P G Sbjct: 569 PPPPLPSTGPPPPPPPPPPLPNQAPPPPP-PPPAPPLPASG 608 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 567 PPPPPPLPSTGPPPPPPPP-----PPLPNQAPPPPPPP 599 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP PP G PPP Sbjct: 547 PPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPP 584 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP + G A PPP Sbjct: 442 PPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPP 479 >UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, inverted; n=1; Gallus gallus|Rep: PREDICTED: similar to formin, inverted - Gallus gallus Length = 1208 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P PP G PPP Sbjct: 395 PPPPLPGMGGIPPPPPLPGMGGIPPPPPLPGLGGIPPP 432 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G PPP Sbjct: 430 PPPPPLPGLAGIPPPPPLPGMGGIPPPPPLSGMGGIPPP 468 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P PP G PPP Sbjct: 407 PPPPLPGMGGIPPPPPLPGLGGIPPPPPLPGLAGIPPP 444 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPP P PP G PPP Sbjct: 419 PPPPLPGLGGIPPPPPLPGLAGIPPPPPLPGMGGIPPP 456 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP G PPP Sbjct: 369 PPPPPLPGMAVIPPPPPLPGMAVIPPPPPPLPGMGGIPPP 408 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXX---TPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G PPP Sbjct: 381 PPPPPLPGMAVIPPPPPPLPGMGGIPPPPPLPGMGGIPPPP 421 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG-GXXAXPPPXGG 699 PPP GG PPP P PP G G PPP G Sbjct: 420 PPPLPGLGGIPPPPPLPGLAGIPPPPPLPGMGGIPPPPPLSG 461 >UniRef50_UPI0000DA3E0C Cluster: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor; n=2; Rattus norvegicus|Rep: PREDICTED: similar to tumor endothelial marker 8 isoform 1 precursor - Rattus norvegicus Length = 542 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 + +K+ PPPP PPPPPPP PP Sbjct: 404 YPEKKEKPPPPVPPPTPPPPPPPPPPPPPPPPP 436 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 PP P PPPPPPP PP A A P Sbjct: 320 PPRPVPPPAPPPPPPPPPPPPRPPPPPAIVRPPAEP 355 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 ++K PPP PPPPPPP PP Sbjct: 408 KEKPPPPVPPPTPPPPPPPPPPPPPPPPPP 437 >UniRef50_Q6P120 Cluster: Enah/Vasp-like b; n=2; Danio rerio|Rep: Enah/Vasp-like b - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 376 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP GG PPPPPP PP G PPP Sbjct: 179 PPPLSLGGPCPPPPPPP-----VPPLPSAGAPPPPPP 210 >UniRef50_A0J0A0 Cluster: Putative lipoprotein precursor; n=2; Alteromonadales|Rep: Putative lipoprotein precursor - Shewanella woodyi ATCC 51908 Length = 508 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +1 Query: 541 GGGGAFXSQKKX---PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 GGGG+ ++K PPPP PPPPPPP PP G Sbjct: 23 GGGGSSTPEEKVEIAPPPPPPP--PPPPPPPPPPPPPPPPPETVG 65 >UniRef50_Q8RVC4 Cluster: P0482D04.1 protein; n=4; Oryza sativa|Rep: P0482D04.1 protein - Oryza sativa subsp. japonica (Rice) Length = 545 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 + S+ + PPPP PPP PPPP+ PP PPP Sbjct: 411 YVSRPQSPPPPLPSDAFEQPPPPPEHPPPPESTSPPPPPTSDPPPVPPP 459 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP + PPP Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 310 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP + PPP Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP + PPP Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP + PPP Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 481 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP + PPP Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP + PPP Sbjct: 239 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 276 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP + PPP Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP PPP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP + PPP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 259 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP + PPP Sbjct: 240 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 277 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP PPP Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 258 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 295 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 268 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 305 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP + PPP Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP + PPP Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPP 334 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 315 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 352 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 325 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 362 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 359 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 396 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 406 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 450 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 429 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 466 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP PP PPP Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 475 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 473 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 510 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 483 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 520 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP PP PPP Sbjct: 275 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 347 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 384 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 461 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 498 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 505 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 542 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PP PPP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 265 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PP PPP Sbjct: 245 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 283 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP +PP PPP Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PPP +PP + PPP Sbjct: 522 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PP PPPP PP + PP Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP P + PPP Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P PP PPP Sbjct: 307 PPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 344 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPP +PP + PPP Sbjct: 335 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 372 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP +PP + PPP Sbjct: 340 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 377 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPP +PP + PPP Sbjct: 379 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 416 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP +PP + PPP Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPP +PP + PPP Sbjct: 449 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 486 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP +PP + PPP Sbjct: 454 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 491 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPP +PP + PPP Sbjct: 493 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 530 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP +PP + PPP Sbjct: 498 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 535 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P PP + PPP Sbjct: 504 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 541 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PP PPPP PP + PP Sbjct: 517 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 192 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 229 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 197 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 234 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 202 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 239 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PPP PP + PPP Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP + PP Sbjct: 261 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 298 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP P PPP Sbjct: 295 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 332 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP + PP Sbjct: 310 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 347 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP + PP Sbjct: 318 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 355 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP P PPP Sbjct: 334 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 371 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 376 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP + PP Sbjct: 354 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 391 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP + PP Sbjct: 362 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 399 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP P PPP Sbjct: 378 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 415 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 383 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 420 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 393 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 430 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP + PP Sbjct: 408 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 445 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP + PP Sbjct: 416 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 453 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP + PP Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 461 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP + PP Sbjct: 432 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP P PPP Sbjct: 448 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 485 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 490 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP + PP Sbjct: 468 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 505 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP + PP Sbjct: 476 PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 513 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP P PPP Sbjct: 492 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 529 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP P PPP Sbjct: 497 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 534 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PPP PP + PPP Sbjct: 517 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PP PPPP PP + PP Sbjct: 522 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPP PP PP PPP Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 252 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPP PP PP PPP Sbjct: 233 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 270 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPP PPP PP + PPP Sbjct: 234 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P PP PPP Sbjct: 250 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 287 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P P + PPP Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 300 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP P PPP Sbjct: 276 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 313 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPP PP PP PPP Sbjct: 285 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 322 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPP PPP PP + PPP Sbjct: 286 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 323 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPP PP PP PPP Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPP 335 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P P + PPP Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P PP + PPP Sbjct: 341 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP P + PPP Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P P + PPP Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 401 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P PP + PPP Sbjct: 455 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 492 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP P + PPP Sbjct: 462 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 499 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P P + PPP Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP P PPP Sbjct: 506 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPP PP PP PPP Sbjct: 515 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 552 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G A S PPPP P PPPPP PP PPP Sbjct: 781 GQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPP 828 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP TPP PPP Sbjct: 799 PPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPP 836 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP +PP PPP Sbjct: 815 PPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPP 852 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP P PPPPP +PP + + PPP Sbjct: 854 PSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPP 891 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPP P +PP + + PPP Sbjct: 876 PSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPP 913 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP P P PP + + PPP Sbjct: 882 PPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPP 919 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PP PPPP PP + PPP Sbjct: 811 PPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPP 848 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PP P PP + PPP Sbjct: 805 PPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPP 842 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 P PP PPPPP P TPP + PP Sbjct: 844 PSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPP 880 >UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; Dictyostelium discoideum|Rep: Diaphanous-related formin dDia2 - Dictyostelium discoideum (Slime mold) Length = 1087 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP GG PPPPPPP P Sbjct: 597 PPPPPMSGGGGPPPPPPPPGGKSNKP 622 Score = 35.1 bits (77), Expect = 2.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPPP Sbjct: 596 PPPPPPMSGGGGPPPPPPP 614 >UniRef50_Q23137 Cluster: Ground-like (Grd related) protein 22; n=1; Caenorhabditis elegans|Rep: Ground-like (Grd related) protein 22 - Caenorhabditis elegans Length = 162 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 GGGG + PPP G PPPPPPP Sbjct: 28 GGGGCAPAAPACAPPPPPMCGCAPPPPPPPP 58 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 GGG A + PPPP G PPPPPPP Sbjct: 29 GGGCAPAAPACAPPPPPMCGCAPPPPPPPPP 59 >UniRef50_A2EVR8 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 434 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PPPP PP A GG PPP Sbjct: 299 PPPMKPQSFAAIPPPGALPPPPPPPPPPPKAPGGGSLPPPP 339 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP--PPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPP P PP P P Sbjct: 324 PPPPKAPGGGSLPPPPPAASPGIAAPPPSTPAPTNQGPLP 363 >UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_73, whole genome shotgun sequence - Paramecium tetraurelia Length = 442 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPPQ PP PPP Sbjct: 121 PPPPPVQN---LPPPPPPPQQNVLPPPPKPQQNVMPPP 155 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 Q PPPP PPPPPP Q PP A P Sbjct: 138 QNVLPPPPKPQQNVMPPPPPPPQQNVMPPPPPPAQQQAQAP 178 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P Q PP PPP Sbjct: 130 PPPPPPPQQNVLPPPPKPQQNVMPPPPPPPQQNVMPPP 167 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 Q+ PPP PPPPPPPQ PP Sbjct: 137 QQNVLPPPPKPQQNVMPPPPPPPQQNVMPP 166 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP+ P PPP Sbjct: 77 PPPPPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPP 114 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G +Q+ PP PPPPPPP PP G PPP Sbjct: 53 GPAQTQQNAPPNTKVIVNKAAPPPPPPP----PPPPPPKGAPPPPPP 95 >UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|Rep: Predicted protein - Neurospora crassa Length = 452 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXP-PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPPP PP A PPP Sbjct: 251 PPPPSSAAPSLPPAPPPPPPTAAPRPPPAPSRSQPPPPP 289 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP GG PPPPPP PP Sbjct: 9 PPPPPGMGGPPPPPPPPPGALPGRPP 34 Score = 35.5 bits (78), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPPP G PPPPPPP P G Sbjct: 6 PPPPPPPPGMGGPPPPPPPPPGALPGRPPAG 36 >UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein; n=1; Yarrowia lipolytica|Rep: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein - Yarrowia lipolytica (Candida lipolytica) Length = 659 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP G PPPPPPP + G A PP Sbjct: 6 PPPPPPPPGFGGPPPPPPPGGGFGALSSGGAPKAGPP 42 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPPPPP PP GG PPP GG Sbjct: 4 PPPPPPP-----PPPGFGGPPPPPPPGGG 27 Score = 35.5 bits (78), Expect = 1.7 Identities = 24/86 (27%), Positives = 26/86 (30%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKFXX 756 PPPP GG PPPPPP + GG PP G + K Sbjct: 9 PPPPPGFGG----PPPPPPPGGGFGALSSGGAPKAGPPKGAPSRDALFSDITKGNKGRLK 64 Query: 757 XXXHRXXPXXGRXGGGXXXXXAPPPP 834 GGG AP P Sbjct: 65 KTQTNDRSAAQTGGGGVLSGGAPKGP 90 Score = 34.7 bits (76), Expect = 3.0 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 10/63 (15%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPP----------XAXGGXXAXPPP 690 GG A S +K P GG PPPP PP P A A PPP Sbjct: 185 GGAPAIPSLRKTSGAPSAPGGFAPPPPPAPPGGAPAIPGAPSVASSYRSASASSGAPPPP 244 Query: 691 XGG 699 GG Sbjct: 245 PGG 247 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP A G PPP Sbjct: 1088 PPPPPP------PPPPPPPPPPPPPPGAIGLTAPPPPP 1119 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP T P PPP Sbjct: 1090 PPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPP 1127 >UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomycotina|Rep: DUF1720 domain protein - Aspergillus clavatus Length = 1485 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPP PPP PP A G A P G Sbjct: 1410 PPPPAPPIAPPAPPPGPPPPPGPPPPPAPPGAAAPAAPAG 1449 >UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family member 4; n=37; Euteleostomi|Rep: Wiskott-Aldrich syndrome protein family member 4 - Homo sapiens (Human) Length = 625 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXG--GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP P G A PPP Sbjct: 507 PPPPLSQPTRGAPPPPPPPPPGPPPPPFTGADGQPAVPPP 546 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP + P P Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP + PPP Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 287 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + P PP PPPPPPP PP PPP Sbjct: 249 RPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP PP PP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP +PP PPP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PP Sbjct: 267 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP PPP Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPP 285 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP PPP Sbjct: 258 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P PPP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP PPP Sbjct: 255 PPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S + PPP PPPPPPP P PPP Sbjct: 247 SPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G + PP P P PPP P+ PP + PPP Sbjct: 221 GPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPP 267 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP +P PP Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPP 309 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP +PP PP Sbjct: 275 PPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPP 312 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP + PP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P + P P Sbjct: 271 PPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSP 308 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P + PP Sbjct: 272 PPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPP 309 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 279 PPPPPPPPPPPPPPPPPSPSPPRKPPSP--SPPVPPPP 314 >UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleostomi|Rep: Ran-binding protein 9 - Homo sapiens (Human) Length = 729 Score = 37.9 bits (84), Expect = 0.33 Identities = 22/59 (37%), Positives = 24/59 (40%), Gaps = 6/59 (10%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTP------PXAXGGXXAXPPPXGG 699 G G A + PPPP PPPPPPP + P A G A P P GG Sbjct: 59 GLGAAAAALLLHPPPPPPPATAAPPPPPPPPPPPASAAAPASGPPAPPGLAAGPGPAGG 117 >UniRef50_P04280 Cluster: Basic salivary proline-rich protein 1 precursor (Salivary proline-rich protein) [Contains: Basic peptide IB-6; Peptide P-H]; n=60; Tetrapoda|Rep: Basic salivary proline-rich protein 1 precursor (Salivary proline-rich protein) [Contains: Basic peptide IB-6; Peptide P-H] - Homo sapiens (Human) Length = 392 Score = 37.9 bits (84), Expect = 0.33 Identities = 26/95 (27%), Positives = 28/95 (29%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKFXX 756 P P GG PPPPP PP G PPP G R + Sbjct: 36 PQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRS--- 92 Query: 757 XXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRPR 861 P GG PPPP K P+ Sbjct: 93 ---PPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQ 124 Score = 37.5 bits (83), Expect = 0.43 Identities = 27/95 (28%), Positives = 28/95 (29%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKFXX 756 P P GG PPPPP PP G PPP G Q K Sbjct: 97 PQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPG------KPQGPPPQGDKSQS 150 Query: 757 XXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRPR 861 P GG PPPP K P+ Sbjct: 151 PRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQ 185 Score = 37.5 bits (83), Expect = 0.43 Identities = 27/95 (28%), Positives = 28/95 (29%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKFXX 756 P P GG PPPPP PP G PPP G Q K Sbjct: 219 PQGPPPQGGNQPQGPPPPPGKPQGPPQQGGNRPQGPPPPG------KPQGPPPQGDKSRS 272 Query: 757 XXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRPR 861 P GG PPPP K P+ Sbjct: 273 PQSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQ 307 Score = 37.1 bits (82), Expect = 0.57 Identities = 26/88 (29%), Positives = 26/88 (29%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKFXX 756 P P GG PPPPP PP G PPP G Q K Sbjct: 158 PQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPG------KPQGPPPQGDKSQS 211 Query: 757 XXXHRXXPXXGRXGGGXXXXXAPPPPXK 840 P GG PPPP K Sbjct: 212 PRSPPGKPQGPPPQGGNQPQGPPPPPGK 239 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 P P GG PPPPP PP G PPP G Sbjct: 280 PQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPG 319 Score = 34.3 bits (75), Expect = 4.0 Identities = 26/97 (26%), Positives = 30/97 (30%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKF 750 K PP G PPPPP + PP GG PP G Q + Sbjct: 157 KPQGPPPQGGNQPQGPPPPPGKPQGPPP--QGGNKPQGPPPPGKPQGPPPQGDKSQSPRS 214 Query: 751 XXXXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRPR 861 P G G PPPP K + P+ Sbjct: 215 PPGKPQGPPPQGGNQPQG------PPPPPGKPQGPPQ 245 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 6/50 (12%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPP-----PPPQXXXT-PPXAXGGXXAXPPPXGG 699 K PPP PPPP PPPQ + P + G PPP GG Sbjct: 56 KPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGG 105 >UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=53; Actinobacteria (class)|Rep: Translation initiation factor IF-2 - Streptomyces avermitilis Length = 1046 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -3 Query: 695 PXGGGXAXXPPXAXGGVXXXWG--GGGGGGXXXPPXXXGGGG 576 P GGG A P GG G GGGGGG P GGGG Sbjct: 346 PGGGGFAGRPGGGGGGFAGRPGGPGGGGGGFAGRPGGPGGGG 387 Score = 33.5 bits (73), Expect = 7.0 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWG-----GGGGGGXXXPPXXXGGGGXFFXXKKAPP 546 GGG P GG G GGGGGG P GGGG F + P Sbjct: 331 GGGGRPGGPGGGGGRPGGGGFAGRPGGGGGGFAGRPGGPGGGGGGFAGRPGGP 383 >UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=58; Pneumocystis carinii|Rep: Protease-1 (PRT1) protein, putative - Pneumocystis carinii Length = 947 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP---PPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP A A PPP Sbjct: 777 PPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPP 817 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP---PPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP A PPP Sbjct: 764 PPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPP 804 Score = 31.9 bits (69), Expect(2) = 0.41 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 803 PPPPAPAPAPAPPPPPPPP 821 Score = 24.6 bits (51), Expect(2) = 0.41 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 616 PPPPPPQXXXTPPXAXGGXXAXPPP 690 P P PPQ PP PPP Sbjct: 839 PEPQPPQPQPEPPVPPPKPQPPPPP 863 >UniRef50_UPI0000E80618 Cluster: PREDICTED: hypothetical protein; n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 248 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG--GXXAXPPPXGG 699 PPPP G P P PP PP A G G P P GG Sbjct: 110 PPPPPPRGADEAPARPAPPAGCPAPPPATGGDGGDGAPRPSGG 152 >UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to Formin homology 2 domain containing 1 (LOC787862), mRNA.; n=1; Bos taurus|Rep: PREDICTED: Bos taurus similar to Formin homology 2 domain containing 1 (LOC787862), mRNA. - Bos Taurus Length = 1125 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP-PXAXGGXXAXPPP 690 PPPP G PPPPPPP +P P A P P Sbjct: 534 PPPPPLLSGSLPPPPPPPPPPLKSPFPPTPPPPPAAPLP 572 >UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; Gallus gallus|Rep: Putative uncharacterized protein - Gallus gallus (Chicken) Length = 1266 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G A P Sbjct: 695 PPPPPVVPGCPPPPPPPPMVPGCPPPPGFSGPSAMDGP 732 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP PP Sbjct: 694 PPPPPPVVPGCPPPPPPPPMVPGCPP 719 >UniRef50_Q82HS3 Cluster: Putative uncharacterized protein; n=1; Streptomyces avermitilis|Rep: Putative uncharacterized protein - Streptomyces avermitilis Length = 412 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 +++ PPP PPPPPPP +P GG PP GG Sbjct: 137 AEEPWSPPPSASTPWSSPPPPPPPDSWSSPVPVVGG--GTPPGSGG 180 >UniRef50_Q5YRG4 Cluster: Putative uncharacterized protein; n=1; Nocardia farcinica|Rep: Putative uncharacterized protein - Nocardia farcinica Length = 522 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP GG PP PPP PP PPP GG Sbjct: 218 PPPGAPGGQQMPPAYPPPHLPAQPPPG-APHPGYPPPAGG 256 >UniRef50_O86637 Cluster: Putative uncharacterized protein SCO5717; n=2; Streptomyces|Rep: Putative uncharacterized protein SCO5717 - Streptomyces coelicolor Length = 1083 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPP G PPPPP P TPP G A P Sbjct: 115 PPPAPAPGAAFTPPPPPGPGAPFTPPAPPSGGPAGVP 151 >UniRef50_Q1GTX9 Cluster: Putative uncharacterized protein precursor; n=4; Sphingomonadales|Rep: Putative uncharacterized protein precursor - Sphingopyxis alaskensis (Sphingomonas alaskensis) Length = 199 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 GGA +Q PPPP PPP PPP PP G Sbjct: 15 GGAVLAQSPPPPPPPA-SSPPPPPPMPPPVALPAPPTCTG 53 >UniRef50_Q022J1 Cluster: Putative secreted protein precursor; n=1; Solibacter usitatus Ellin6076|Rep: Putative secreted protein precursor - Solibacter usitatus (strain Ellin6076) Length = 663 Score = 37.5 bits (83), Expect = 0.43 Identities = 24/71 (33%), Positives = 25/71 (35%), Gaps = 2/71 (2%) Frame = +1 Query: 484 GGXKXXXXXGXXFFFXXXXGGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAX 663 GG G F G + PPPP PPPPPPP P A Sbjct: 155 GGQGDVSVYGHLLFMSAEAMNGRLDCGTQGNPPPPGYT-----PPPPPPPAETAAAPGAP 209 Query: 664 GGXXA--XPPP 690 GG A PPP Sbjct: 210 GGGRAPRVPPP 220 >UniRef50_Q93107 Cluster: Myosin I heavy chain kinase; n=1; Acanthamoeba castellanii|Rep: Myosin I heavy chain kinase - Acanthamoeba castellanii (Amoeba) Length = 753 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG AF + PPPP G PPPPP P P P Sbjct: 165 GGSAAFVDDEPPPPPPPRDDGEFEAPPPPPVPREQEPEPQQAPLSPPPRP 214 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP G A PPP Sbjct: 161 PPPPGGSAAFVDDEPPPPP-----PPRDDGEFEAPPPP 193 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 P PP G PP P PP+ PP A A P Sbjct: 417 PTPPIATGARPAPPRPQPPKAGGAPPPAAAPQPARP 452 >UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila melanogaster|Rep: CG5514-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 1150 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP A PPP Sbjct: 402 PPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPP 439 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPPP P + PP A PPP Sbjct: 458 KVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPP 498 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPP 450 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 437 PPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPP 474 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP + PP A PPP Sbjct: 436 PPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPP 476 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 449 PPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPP 486 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P + PP A PPP Sbjct: 450 PPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPP PPPP PP PP PPP Sbjct: 423 KPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPP 463 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PPP Sbjct: 448 PPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPP 485 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 PPPP PPPP PP+ PP A Sbjct: 472 PPPPPAPTELEPPPPPAPPKVELPPPPA 499 >UniRef50_Q7KUL0 Cluster: CG9425-PB, isoform B; n=4; Diptera|Rep: CG9425-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 2103 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GGGG + PPPP P PPP Q P GG PPP G Sbjct: 1384 GGGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQ----QPGGAGGGGGPPPPYG 1431 >UniRef50_Q1XIS2 Cluster: Formactin; n=4; Caenorhabditis|Rep: Formactin - Caenorhabditis elegans Length = 1346 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 601 GXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 G PPPPPPP PP GG PPP G Sbjct: 766 GVGVPPPPPPPSAIPLPPRLQGG-IPPPPPLG 796 >UniRef50_A2ELJ5 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 1386 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPP---PQXXXTPPXAXGGXXAXPPP 690 S K PPP GG PPPP P PP GG PPP Sbjct: 257 SMFKPNPPPFPSGGLPPMPPPPSQELPSKPVQPPFPSGGLPPMPPP 302 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 G GG PPPP PPPPPPP P G PPP G Sbjct: 1086 GAGGPPPPPPPPPPPPMPGMAGMPPPPPPPPPM----PGMPGMPPPPPPPMPG 1134 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P P G PPPPPPP PP GG PP G Sbjct: 1051 PAPIPGAGGPPPPPPPPP----PPPPPPGGLPGAAPPMPG 1086 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P G PPPPPPP PP G P GG Sbjct: 1051 PAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGG 1089 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = -2 Query: 831 GGGGPXXXTPPPPXPXXXXGAVGGRGXKFFLLXXXXXXXXXXPXPPXXGGXGPXPPP 661 G GGP PPPP P G + G P PP G G PPP Sbjct: 1056 GAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPPPP 1112 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P G PPP Sbjct: 1030 PPPPPPP----PPPPPPPPGFLPGAPAPIPGAGGPPPP 1063 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P P G PPPPPPP PP G A P GG Sbjct: 1021 PSAPAAASGP--PPPPPPPPPPPPPPGFLPGAPAPIPGAGG 1059 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXP 335 PPP P P P GG PPP PPPPP GG P Sbjct: 1031 PPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPP----PPPPPPPPGGLP 1078 Score = 33.5 bits (73), Expect = 7.0 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 11/61 (18%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXX-----------PPPPPPPQXXXTPPXAXGGXXAXPP 687 G GG PPPP GG PPPPPPP PP G PP Sbjct: 1056 GAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPP-----PPPPMPGMAGMPP 1110 Query: 688 P 690 P Sbjct: 1111 P 1111 >UniRef50_Q4WG58 Cluster: Actin cortical patch assembly protein Pan1, putative; n=9; Fungi/Metazoa group|Rep: Actin cortical patch assembly protein Pan1, putative - Aspergillus fumigatus (Sartorya fumigata) Length = 1467 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPP PPP PP A P P G Sbjct: 1392 PPPPAPPMAPPAPPPGPPPPPGPLPPPAPPAASGPPTPAG 1431 >UniRef50_A7LNW5 Cluster: Hydrophobin; n=1; Trichoderma atroviride|Rep: Hydrophobin - Trichoderma atroviride (Hypocrea atroviridis) Length = 217 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP--PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPP P P GG GG Sbjct: 67 PPPPKNGGGKYPPPPPPPSSPPYSTAPHNGGGGGNGGNGGNGG 109 >UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 737 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP A A PPP Sbjct: 422 PPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPDAPPPP 461 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP---PPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PP A PPP Sbjct: 397 PPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPP 437 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP PP A A PPP Sbjct: 416 PPPPDEPPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPP 455 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPP P PP G PP G Sbjct: 446 PPPPDAPPPPDAPPPPDEPPPPGEPPALEGPPAGGKPPAFG 486 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPP PP P PPP Sbjct: 177 PPPPVRPPGLGRPPPNKPPPPVEPPAPERAPAPGKPPP 214 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 379 PPPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPP 418 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPP P PP PP GG Sbjct: 440 PPPPDAPPPPDAPPPPDAPPPPDEPPPPGEPPALEGPPAGG 480 >UniRef50_A3LN86 Cluster: Protein involved in actin organization and endocytosis; n=2; Saccharomycetales|Rep: Protein involved in actin organization and endocytosis - Pichia stipitis (Yeast) Length = 1373 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GA + PP P PPPPPPP PP PPP Sbjct: 1269 GAPPIPTEAPPIPVGGPSSFAPPPPPPPPPPPGPPPIPNAPFGAPPP 1315 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 583 PPXXXGGXXX---PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP GG PPPPPPP PP A PPP Sbjct: 1278 PPIPVGGPSSFAPPPPPPPPPPPGPPPIPNAPFGAPPPP 1316 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXP-----PPPPPPQXXXTPPXAXGGXXAXP 684 GG + + PPPP G P PPPPP PP G A P Sbjct: 1283 GGPSSFAPPPPPPPPPPPGPPPIPNAPFGAPPPPPPPPGPPPPVSNGVTAPP 1334 >UniRef50_Q69U86 Cluster: Putative uncharacterized protein P0414C05.16; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein P0414C05.16 - Oryza sativa subsp. japonica (Rice) Length = 137 Score = 29.1 bits (62), Expect(2) = 0.47 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXG 666 PPPPPPP PP G Sbjct: 27 PPPPPPPPSPGLPPSGSG 44 Score = 27.5 bits (58), Expect(2) = 0.47 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 598 GGXXXPPPPPPP 633 GG PPPPPPP Sbjct: 20 GGVLLPPPPPPP 31 >UniRef50_UPI00015B5C43 Cluster: PREDICTED: similar to homeobox protein prospero/prox-1; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to homeobox protein prospero/prox-1 - Nasonia vitripennis Length = 1168 Score = 28.7 bits (61), Expect(2) = 0.52 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 613 PPPPPPPQXXXTPP 654 PPPPPPP+ PP Sbjct: 882 PPPPPPPRPYHAPP 895 Score = 27.5 bits (58), Expect(2) = 0.52 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 598 GGXXXPPPPPPP 633 GG PPPPPPP Sbjct: 875 GGAESPPPPPPP 886 >UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous 1; n=1; Monodelphis domestica|Rep: PREDICTED: similar to diaphanous 1 - Monodelphis domestica Length = 1186 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT-PPXA---XGGXXAXPPP 690 PPPP G PPPPPPP PP + G PPP Sbjct: 596 PPPPPLPGSISIPPPPPPPPPLPVLPPPSPLPLPGSTGIPPP 637 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPP P PP A GG P Sbjct: 635 PPPPPLLGGPGIPPPLPGMCLPPPPPPAFGGLGVTSAP 672 >UniRef50_UPI0000E45FF5 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 929 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 ++ PPPP G PPPPPP + PP + PPP Sbjct: 714 AESPLPPPPLPDG---PPPPPPPGEEPALPPLPPSPPPSTPPP 753 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPP---XAXGGXXAXPPP 690 PP PPPPPPP PP A GG PPP Sbjct: 450 PPSPLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPP 488 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP TP PPP Sbjct: 471 PPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPPP 508 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG PPPP G PPPPPPP GG PPP Sbjct: 480 GGGPPPPPPPPPPPTPMIGVPPPPPPPPPSVF------AGGQQQQPPP 521 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP A GG PPP Sbjct: 458 PPPPPP------PPPPPPPPPPTQSSAAGGGPPPPPPP 489 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP G PPP Sbjct: 470 PPPPTQSSAAGGGPPPPPP--PPPPPTPMIGVPPPPPP 505 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P A G P P Sbjct: 505 PPPPSVFAGGQQQQPPPPPPPPPPPGAASQGSSQGPSP 542 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXX----PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP GG PPPPPPP + + G PP GG Sbjct: 506 PPPSVFAGGQQQQPPPPPPPPPPPGAASQGSSQGPSPLPAPPHGG 550 >UniRef50_UPI0000DA1F1A Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 432 Score = 37.1 bits (82), Expect = 0.57 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPP------XAXGGXXAXPPP 690 GG F + PPPP PPPPPPP PP A G PPP Sbjct: 288 GGPFGGEAPPPPPP-----PPPPPPPPPPPAPRDPPEDVREDPAAAGLEDKPPP 336 >UniRef50_UPI000023F6A5 Cluster: hypothetical protein FG10389.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG10389.1 - Gibberella zeae PH-1 Length = 1061 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P PP G PPP GG Sbjct: 802 PPPPGPPRGLSTGPPPPGPPGPPPPPGPPG-----PPPSGG 837 >UniRef50_UPI0000F30461 Cluster: Formin-2.; n=2; Bos taurus|Rep: Formin-2. - Bos Taurus Length = 1349 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP P TPP G PP G Sbjct: 820 PPPPPLPGVGIPPPPPLPTVGIPTPPPLPGVGIPPAPPLPG 860 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPP G PPPPP P PP G PP Sbjct: 919 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPP 954 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP G PPPPP P PP G PPP Sbjct: 908 PPAPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPP 944 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P PP PP Sbjct: 808 PPPPLPLPGVGVPPPPPLPGVGIPPPPPLPTVGIPTPP 845 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP P G PPPP P PP G PPP G Sbjct: 908 PPAPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPG 948 >UniRef50_Q4RLP1 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 826 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 577 PPPPXXXG--GXXXPPPPPPPQXXXT---PPXAXGGXXAXPPPXG 696 PPPP G G PPP PPP + PP G PPP G Sbjct: 332 PPPPPLPGSLGVAPPPPAPPPPFMGSGPPPPPPVPGMPCPPPPPG 376 >UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1225 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPPP TPP PPP Sbjct: 718 KAAPPPPPPPKAATPPPPKAVTPPPPPKAVTPPPPPKAVTPPPPP 762 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 QK PPPP PPPPPP TPP PP Sbjct: 708 QKVIPPPPPPKAA----PPPPPPPKAATPPPPKAVTPPPPP 744 >UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subunit p20 precursor; n=3; Bradyrhizobiaceae|Rep: Peptidase C14, caspase catalytic subunit p20 precursor - Rhodopseudomonas palustris (strain BisA53) Length = 1067 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 992 PPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPP 1029 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA 660 PPPP PPPPPPP PP A Sbjct: 1026 PPPPPVVRPPPPPPPPPPPAARPAPPAA 1053 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 ++ PPPP PPPPPP PP A PPP Sbjct: 970 RQAPPPPP---AARPAPPPPPPVVRPPPPPPPAARPAPPPP 1007 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + PPPP PPPPP + PP A PPP Sbjct: 991 RPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPP 1030 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPP-------PPPQXXXTPPXAXGGXXAXPPP 690 + PPPP PPPP PPP PP A PPP Sbjct: 940 RPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPP 986 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP A P P Sbjct: 1013 PPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARPAP 1050 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 933 PPPPPVV---RPPPPPPPPAAHPAPPPPVVRPAPPPPP 967 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 983 PPPPPPV---VRPPPPPPPAARPAPPPPPPVVRPPPPP 1017 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 1004 PPPPPPV---VRPPPPPPPAARPAPPPPPPVVRPPPPP 1038 >UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like protein precursor; n=5; Mycobacterium|Rep: U5 snRNP spliceosome subunit-like protein precursor - Mycobacterium sp. (strain JLS) Length = 137 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXA 678 PPPP PPPPPPP PP G A Sbjct: 90 PPPPPGAPPPPPPPPPPPPPPVYVPPPPVGNIDA 123 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPPPP PP PPP G Sbjct: 85 PPPPPPPPPPGAPPPPPPPPPPPPPP-----VYVPPPPVG 119 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPPP P PP PPP Sbjct: 458 PPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPP 495 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP---QXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP A PPP Sbjct: 456 PPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPP 496 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPP PP PP Sbjct: 469 PPPPPPAPSPPAPPPPPPAPSPPAPPPPPPPCPPAPP 505 >UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=3; Oryza sativa (japonica cultivar-group)|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 1779 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 1380 PPPPPAAPSPLAPPPPPPPPCPPAPPKTRS--RQAPPP 1415 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPP--PPQXXXTPPXAXGGXXAXPPP 690 G AF + PP PPPPP P PP A A PPP Sbjct: 1344 GRQAAFRAPSPPAPPSPPAPSPPAPPPPPAAPSPSAPPPPPAAPSPLAPPPP 1395 >UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=2; Ostreococcus|Rep: RhoA GTPase effector DIA/Diaphanous - Ostreococcus tauri Length = 1105 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXG-GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP A A PPP Sbjct: 434 PPPPKRIGCDITHPPPPPPPPPFARAQSANANVSAPPPP 472 Score = 31.1 bits (67), Expect(2) = 3.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP PP G PP Sbjct: 472 PPPPPPPPPPPPPPRPSLGPIVPTPP 497 Score = 22.2 bits (45), Expect(2) = 3.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 601 GXXXPPPPPP 630 G PPPPPP Sbjct: 428 GPPPPPPPPP 437 >UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaster|Rep: CG15021-PA - Drosophila melanogaster (Fruit fly) Length = 420 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP P G PPPPPPP+ TP G PPP G Sbjct: 213 PPRPQPTPGYGPPPPPPPPKPQPTP----GYGPPTPPPGPG 249 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP G PPP PPPQ + P G PP Sbjct: 138 PAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPP 175 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPP 687 PPP G PPP PPPQ + PP + G PP Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPP 152 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 594,024,140 Number of Sequences: 1657284 Number of extensions: 14668458 Number of successful extensions: 195048 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 38274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130706 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 76243001646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -