BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B01 (862 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 44 2e-04 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 43 4e-04 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 41 0.001 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 40 0.003 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 40 0.003 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.004 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 38 0.008 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 38 0.014 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 37 0.018 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 37 0.024 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 36 0.042 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.056 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.056 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 35 0.098 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 34 0.13 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 34 0.13 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 34 0.13 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 34 0.13 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 34 0.17 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.69 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 32 0.69 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.69 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 32 0.69 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.69 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 32 0.69 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.2 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.2 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 27 1.5 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 31 1.6 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 31 1.6 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 2.1 SB_39066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.8 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 2.8 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 30 2.8 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 29 3.7 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) 26 4.3 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 4.9 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 29 4.9 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 29 4.9 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 29 4.9 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 29 4.9 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 29 6.4 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 29 6.4 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.4 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 29 6.4 SB_46953| Best HMM Match : DUF1014 (HMM E-Value=0.83) 25 7.7 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 8.5 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 28 8.5 SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) 28 8.5 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 24 8.8 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPP PP G PPP GG Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGG 961 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPP + P GG PPP G Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPG 960 Score = 41.9 bits (94), Expect = 6e-04 Identities = 25/51 (49%), Positives = 26/51 (50%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 GG+ SQ PPPP GG PPPPPP PP GG PPP GG Sbjct: 938 GGSAPSQ---PPPP---GGNA--PPPPPPPGGSAPPPG-GGAPPLPPPPGG 979 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGG-XXAXPPPXGG 699 P GG PPPPPP PP GG + PPP GG Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGG 950 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P PP GG PPPP PP GG + PPP GG Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPPPPGG--SAPPPGGG 969 Score = 34.7 bits (76), Expect = 0.098 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 GG A PP P GG PPPPPPP Sbjct: 960 GGSAPPPGGGAPPLPPPPGGSAPPPPPPPP 989 Score = 33.5 bits (73), Expect = 0.23 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKK 522 PP GG A PP GG GGG PP GG PPPP +K Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGA------PPLPPPPGGSAPPPPPPPPPPPPPMRK 997 Score = 32.7 bits (71), Expect = 0.39 Identities = 30/112 (26%), Positives = 30/112 (26%) Frame = -3 Query: 668 PPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKKXXPXXXXXFX 489 P GG GG PP GG PPPP P Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPL------PPPPPGGSAPSQPP------- 946 Query: 488 PPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFXXGXPPPPPXGGXPP 333 PP P P P GG PP PPPPP PP Sbjct: 947 PPGGNAPPPPPPPGGSAPP------PGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 32.7 bits (71), Expect = 0.39 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKK 519 PP GG A PP GG GG PP GG APPP Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGG--------SAPPPGGGAPPLP 974 Query: 518 XXPXXXXXFXPPXXXXPXXP 459 P PP P P Sbjct: 975 PPPGGSAPPPPPPPPPPPPP 994 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 GGGA PPPP PPPPPPP Sbjct: 967 GGGA----PPLPPPPGGSAPPPPPPPPPPP 992 Score = 31.9 bits (69), Expect = 0.69 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PP PP PP + P PPP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 ++ P GG P PP PP GG PPP G Sbjct: 895 RRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPG 938 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 727 PPLXGGXXXSPPXGGXGPXPPP 662 PP G PP GG P PPP Sbjct: 965 PPGGGAPPLPPPPGGSAPPPPP 986 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -1 Query: 727 PPLXGGXXXS--PPXGGXGPXPPP 662 PP GG S PP GG P PPP Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPP 957 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP-PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP P PP G A PPP G Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +1 Query: 577 PPPPXXXGGXXX--PPPPPPPQXXXT---PPXAXGGXXAXPPPXG 696 PPPP GG PPPPPPP PP GG PPP G Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXA 678 PPPP GG PPPPP PP G A Sbjct: 678 PPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGGFA 711 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 GG PPPP G PPPP PP GG P G Sbjct: 669 GGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGGFANLVKPRKG 719 Score = 32.3 bits (70), Expect = 0.52 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 GG A + PPPP GG PPPPPP PP G Sbjct: 669 GGQAGGAPP--PPPPPLPGG-AAPPPPPPIGGGAPPPPPPG 706 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = -1 Query: 409 GGXPPPXXXFFXXGX--PPPPPXGGXPP 332 GG PPP G PPPPP GG P Sbjct: 673 GGAPPPPPPPLPGGAAPPPPPPIGGGAP 700 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 804 PPPPXPXXXXGAVGGRGXKFFLLXXXXXXXXXXPXPPXXGGXGPXPPPG 658 PPPP P G GG P PP GG P PPPG Sbjct: 660 PPPPPPPPPGGQAGGAPPP--PPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 6/39 (15%) Frame = +1 Query: 601 GXXXPPPPPP------PQXXXTPPXAXGGXXAXPPPXGG 699 G PPPPPP PP G PPP GG Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGG 697 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXG 344 PPP P P G GG PP G PPPPP G Sbjct: 660 PPPPPPP--PPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -1 Query: 727 PPLXGG--XXXSPPXGGXGPXPPP 662 PPL GG PP GG P PPP Sbjct: 681 PPLPGGAAPPPPPPIGGGAPPPPP 704 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 K PPPP G PPPPPP PP G PPP G Sbjct: 373 KPPPPPPPTNGP--PPPPPPTNGPPPPPPPTNGPPPPPPPTNG 413 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPP PP G PPP G Sbjct: 365 PPPPPPTN--KPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG 403 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPP PP G PPP G Sbjct: 357 PPPPTNN----TPPPPPPTNKPPPPPPPTNGPPPPPPPTNG 393 Score = 33.5 bits (73), Expect = 0.23 Identities = 27/99 (27%), Positives = 28/99 (28%) Frame = -3 Query: 632 GGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXX 453 G GGGG PP +PPPP P PP P P Sbjct: 337 GTSGGGGVNPPPPPTNN-------PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Query: 452 PFXXXXXFFXXXFXXGGXPPXXXXFXXGXPPPPPXGGXP 336 P G PP PPPPP G P Sbjct: 390 P-------------TNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 33.1 bits (72), Expect = 0.30 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = -3 Query: 587 GGGGXFFXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXX 408 GGGG PPPP P PP P P P Sbjct: 340 GGGGV-----NPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP-------------T 381 Query: 407 GGXPPXXXXFXXGXPPPPPXGGXPP 333 G PP PPPPP G PP Sbjct: 382 NGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 4/30 (13%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP----PPPPQXXXTPP 654 PPPP G PPP PPPP PP Sbjct: 386 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 4/61 (6%) Frame = -1 Query: 832 GGGG----PXXXNXPPPXAXXXXXXXXXXXXXXXXXXXVPPLXGGXXXSPPXGGXGPXPP 665 GGGG P N PP PP G PP G P PP Sbjct: 340 GGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Query: 664 P 662 P Sbjct: 400 P 400 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP 332 PPP PPPPP G PP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPP 396 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP 332 PPP PPPPP G PP Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPP 406 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP GG PPPPPP PP + G PPP G Sbjct: 365 PPPPPPVGG----PPPPPPPIEGRPPSSLGNPPPPPPPGRG 401 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPPP PP G PPP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP 368 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 S+ PPPP G PPPPP PP + G A PPP G Sbjct: 310 SRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG---APPPPSMG 352 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PP PPPPP PP PPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPP 328 Score = 34.3 bits (75), Expect = 0.13 Identities = 25/94 (26%), Positives = 26/94 (27%) Frame = -3 Query: 614 GXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXX 435 G PP G + APPPP P PP P Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRP-PPPS 342 Query: 434 XFFXXXFXXGGXPPXXXXFXXGXPPPPPXGGXPP 333 G PP PPPPP GG PP Sbjct: 343 RGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPP 376 Score = 32.7 bits (71), Expect = 0.39 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PP PPPP PP PPP G Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVG 372 Score = 31.5 bits (68), Expect = 0.91 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 G A + PPP G PPPP PP PPP G Sbjct: 294 GAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRG 344 Score = 31.5 bits (68), Expect = 0.91 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 4/30 (13%) Frame = +1 Query: 577 PPPPXXXG----GXXXPPPPPPPQXXXTPP 654 PPPP G PPPPPPP PP Sbjct: 376 PPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 406 GXPPPXXXFFXXGXPPPPPXGGXPP 332 G PP PPPPP GG PP Sbjct: 352 GMAPPPVGGAAPPPPPPPPVGGPPP 376 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 619 PPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPPP PP G PP G Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRG 312 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPP-----PPQXXXTPPXAXGGXXAXPPP 690 GGGA PPPP G PPPPP PP PP G A PPP Sbjct: 286 GGGA-----PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PPPPPP PP GG PPP Sbjct: 304 PPPPPPPGGA---PPPPPP--PPPPPPGDGGAPPPPPP 336 Score = 35.5 bits (78), Expect = 0.056 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 GGA PPPP GG PPPPPPP Sbjct: 311 GGAPPPPPPPPPPPPGDGGA--PPPPPPP 337 Score = 31.9 bits (69), Expect = 0.69 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP 332 PPP PPPPP GG PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPP 315 Score = 31.5 bits (68), Expect = 0.91 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT----PPXAXGGXXAXPPP 690 P P G P PPPPP PP GG PPP Sbjct: 278 PEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPP 319 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP 332 PPP PPPPP G PP Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPP 316 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 Query: 828 GGGPXXXTPPPPXPXXXXGA 769 GG P PPPP P GA Sbjct: 311 GGAPPPPPPPPPPPPGDGGA 330 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -2 Query: 699 PPXXGGXGPXPPP 661 PP GG P PPP Sbjct: 324 PPGDGGAPPPPPP 336 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 41.1 bits (92), Expect = 0.001 Identities = 37/122 (30%), Positives = 38/122 (31%), Gaps = 2/122 (1%) Frame = +1 Query: 337 GXPPXGGG--GGXPXKKXXXXGGXPPXKKXXXKXLXXXKKGXXGXXGXXKXGGXKXXXXX 510 G PP G G GG P GG PP G G G Sbjct: 491 GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 550 Query: 511 GXXFFFXXXXGGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G + G G Q PPPP G PPPP Q PP A G PPP Sbjct: 551 GAGQGWGQPPPGAG----QGGGPPPPG--AGQGGPPPPGAGQEGPPPPGA--GQGGGPPP 602 Query: 691 XG 696 G Sbjct: 603 PG 604 Score = 38.7 bits (86), Expect = 0.006 Identities = 35/134 (26%), Positives = 40/134 (29%), Gaps = 3/134 (2%) Frame = +3 Query: 333 GGXPPXGGGGGXPXXKXXXXGGGXPP---XKXXXKKXXXXXKGXPXGXXGXXXGGGKXXX 503 G PP G GG P GGG PP + + +G G GGG Sbjct: 491 GQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 550 Query: 504 XXGRXFFFXXXXGGGGGFFXXKKXPPPPXXXXGXXXAXXXXXXXXXXXXXTXXGGGXGPX 683 G+ + G GG PPPP G G G GP Sbjct: 551 GAGQGWGQPPPGAGQGG------GPPPPGAGQG---GPPPPGAGQEGPPPPGAGQGGGPP 601 Query: 684 PPXGGXXXXPPXRG 725 PP G P G Sbjct: 602 PPGAGQGWGLPPPG 615 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPP Q PP G PPP G Sbjct: 503 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG 542 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPP Q PP G PPP G Sbjct: 536 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAG 575 Score = 36.3 bits (80), Expect = 0.032 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 GGG Q PPP GG PPPP Q PP G PPP G Sbjct: 485 GGGQGWGQ---PPPGAGQGG--GPPPPGAGQGGGPPPPGAGQGWGQPPPGAG 531 Score = 35.1 bits (77), Expect = 0.074 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP GG PPPP Q PP G PPP G Sbjct: 526 PPPGAGQGG--GPPPPGAGQGGGPPPPGAGQGWGQPPPGAG 564 Score = 34.3 bits (75), Expect = 0.13 Identities = 35/124 (28%), Positives = 35/124 (28%), Gaps = 6/124 (4%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWG----GGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXX 531 PP G G PP G WG G G GG PP GGG PPPP Sbjct: 504 PPPGAGQGGGPPPPGAG--QGWGQPPPGAGQGGGPPPPGAGQGGG--------PPPPGAG 553 Query: 530 XKKKXXP--XXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFXXGXPPP 357 P PP P P GG PP PP Sbjct: 554 QGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPP 613 Query: 356 PPXG 345 P G Sbjct: 614 PGSG 617 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPP Q PP G PPP G Sbjct: 514 PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAG 553 Score = 31.5 bits (68), Expect = 0.91 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPP PP A G PPP G Sbjct: 547 PPPPGAGQGWGQPPPGAGQGGGPPPPGA--GQGGPPPPGAG 585 Score = 30.3 bits (65), Expect = 2.1 Identities = 35/141 (24%), Positives = 37/141 (26%) Frame = +3 Query: 306 PGEKKKKXXGGXPPXGGGGGXPXXKXXXXGGGXPPXKXXXKKXXXXXKGXPXGXXGXXXG 485 P ++ K G P G G G P GG PP G G G Sbjct: 472 PAKQIMKQMGKVPGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAG 531 Query: 486 GGKXXXXXGRXFFFXXXXGGGGGFFXXKKXPPPPXXXXGXXXAXXXXXXXXXXXXXTXXG 665 G G G GGG PPPP G Sbjct: 532 QGGGPPPPG--------AGQGGG-------PPPP--GAGQGWGQPPPGAGQGGGPPPPGA 574 Query: 666 GGXGPXPPXGGXXXXPPXRGG 728 G GP PP G PP G Sbjct: 575 GQGGPPPPGAGQEGPPPPGAG 595 Score = 29.9 bits (64), Expect = 2.8 Identities = 35/124 (28%), Positives = 35/124 (28%), Gaps = 2/124 (1%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKK 519 P G G PP A G G G GG PP G G PPP Sbjct: 484 PGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWG-------QPPPGAGQGGGP 536 Query: 518 XXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFXXGXPPPPPXG-- 345 P PP P GG PP G PPPP G Sbjct: 537 PPPGAGQGGGPPPPGAGQGWGQP--------PPGAGQGGGPPPPGA-GQGGPPPPGAGQE 587 Query: 344 GXPP 333 G PP Sbjct: 588 GPPP 591 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPPP GG PPPPPPP PP GG Sbjct: 201 PPPPGFPGGA--PPPPPPPFGAPPPPALNGG 229 Score = 37.5 bits (83), Expect = 0.014 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPPP G PPPPPP PP A G Sbjct: 198 PPPPPPPGFPGGAPPPPPPPFGAPPPPALNG 228 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -1 Query: 415 FXGGXPPPXXXFFXXGXPPPPPXGGXPPXXF 323 F GG PPP F G PPPP G PP + Sbjct: 206 FPGGAPPPPPPPF--GAPPPPALNGGPPREY 234 Score = 31.5 bits (68), Expect = 0.91 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP G PPPPP PP Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP 332 PPP F PPPPP G PP Sbjct: 200 PPPPPGFPGGAPPPPPPPFGAPP 222 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP A PPP Sbjct: 195 PPPP--------PPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 616 PPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPPPP PP GG PPP G Sbjct: 195 PPPPPP---PPPPGFPGGAPPPPPPPFG 219 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPX--GGXPP 332 PPP F G PPPPP G PP Sbjct: 199 PPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 416 FXXGGXPPXXXXFXXGXPPPPPXGGXPPXXF 324 F G PP F G PPPP G PP + Sbjct: 206 FPGGAPPPPPPPF--GAPPPPALNGGPPREY 234 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP A PPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPPPPPP PP A PPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G S PPPP PPPPPPP P PPP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 36.3 bits (80), Expect = 0.032 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 36.3 bits (80), Expect = 0.032 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP PP PPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 36.3 bits (80), Expect = 0.032 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP PP PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 35.9 bits (79), Expect = 0.042 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP--PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPPPQ PP PPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP PPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP PP PPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP PPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP PP PPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 35.5 bits (78), Expect = 0.056 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPPPPP PP PPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 35.5 bits (78), Expect = 0.056 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 Q PPPP PPPPPPP PP Sbjct: 394 QPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP PP A PP Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.1 bits (67), Expect(2) = 0.004 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPP 654 PP PPPPPPP PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPP 119 Score = 27.5 bits (58), Expect(2) = 0.004 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 613 PPPPPPPQXXXTPP 654 PPPPPPP PP Sbjct: 139 PPPPPPPPAPCMPP 152 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT-----PPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP G PPP Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPP 742 Score = 36.7 bits (81), Expect = 0.024 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP G PPP Sbjct: 727 PPPPSPQPGCAGLPPPPPP-----PPPGCAGLPPPPPP 759 Score = 35.1 bits (77), Expect = 0.074 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP G PPPPPP PP G PP Sbjct: 699 PPPPPLLSGTLPMPPPPPP-----PPPGCAGLPPPPP 730 Score = 34.7 bits (76), Expect = 0.098 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +1 Query: 568 KKXPPPPXXX----GGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 KK PPPP G PPPPPP PP G PPP Sbjct: 674 KKVPPPPPPLPVIEGSSLSVPPPPPP----PPPPLLSGTLPMPPP 714 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 Q PPPP PPPPPPPQ PP Sbjct: 679 QTMVPPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP PP + PPP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 32.3 bits (70), Expect = 0.52 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXP 684 PPPP PPPP PPP TPP G P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP PP PPP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 31.9 bits (69), Expect = 0.69 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP PP PPP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 31.5 bits (68), Expect = 0.91 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPP PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 31.5 bits (68), Expect = 0.91 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP PP PPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPP 710 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP GG PPPPPPP PP A PPP G Sbjct: 188 PPPPS--GGPPPPPPPPPP-----PPPPPILELAAPPPPG 220 Score = 36.7 bits (81), Expect = 0.024 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP--PQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPP P P + PPP GG Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGG 194 Score = 34.7 bits (76), Expect = 0.098 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPP--PQXXXTPP-----XAXGGXXAXPP 687 SQ PPPP PPPPPP P PP A GG PP Sbjct: 121 SQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P P P PP + G PPP Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPP 202 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT----PPXAXGGXXAXPPP 690 PPP P PPPPP T PP PPP Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPP 153 Score = 28.7 bits (61), Expect(2) = 0.26 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPP 350 GG PPP G PPPPP Sbjct: 149 GGPPPPPPIAPATGGPPPPP 168 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P P P PPPPP+ TP A + PPP Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQA----PSPPPP 129 Score = 23.4 bits (48), Expect(2) = 0.26 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 370 GXPPPPPXGGXPP 332 G PPPPP PP Sbjct: 193 GGPPPPPPPPPPP 205 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPPP GG PPPPPP + PP GG Sbjct: 196 PPPPPGPGGI--PPPPPPIRGGVPPPPPMGG 224 Score = 35.1 bits (77), Expect = 0.074 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPPP P PP G PPP GG Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPPMGG 224 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXA 678 PPPP G PPPPP PP GG A Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPPMGGGSLA 228 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 407 GGXPPXXXXFXXGXPPPPPXGG 342 GG PP G PPPPP GG Sbjct: 203 GGIPPPPPPIRGGVPPPPPMGG 224 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP P PP GG PP GG Sbjct: 197 PPPPGPGGIPPPPPPIRGGVPPPPPMGGG 225 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 36.7 bits (81), Expect = 0.024 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 665 PXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPP 543 P G GGGGGGG GGGG F + PPP Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 35.9 bits (79), Expect = 0.042 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP 651 PPPP PPPPPPP TP Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT 648 PPPP PPPPPPP T Sbjct: 1164 PPPPPSSPSPPPPPPPPPPPPTPT 1187 Score = 32.3 bits (70), Expect = 0.52 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT 648 PPPP PPPPPPP T Sbjct: 1165 PPPPSSPSPPPPPPPPPPPPTPTT 1188 Score = 31.5 bits (68), Expect = 0.91 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F + + PPPP PPPPPPP +PP P P Sbjct: 1150 FSVRDQIPPPP--------PPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT 648 PPP PPPPPPP T Sbjct: 1166 PPPSSPSPPPPPPPPPPPPTPTTT 1189 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 35.9 bits (79), Expect = 0.042 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPP 633 GGG F PPPP GG PP PPPP Sbjct: 658 GGGMFPP----PPPPPPGGGVPGPPKPPPP 683 Score = 34.7 bits (76), Expect = 0.098 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 PPP GG PPPPPPP Sbjct: 653 PPPPPGGGMFPPPPPPPP 670 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 415 FXGGXPPPXXXFFXXGXPPPPPXGGXPP 332 F GG PPP PPPPP GG P Sbjct: 648 FFGGIPPPPPGGGMFPPPPPPPPGGGVP 675 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP G PPPPPP PP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPP 678 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPP-----PPPPQXXXTPPXAXGGXXAXPPP 690 A Q PP P GG PPP PPPP PP GG P P Sbjct: 636 AHDEQDARPPNPFF-GGIPPPPPGGGMFPPPP-----PPPPGGGVPGPPKP 680 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 724 PLXGGXXXSPPXGGXGPXPPP 662 P GG PP GG P PPP Sbjct: 647 PFFGGIPPPPPGGGMFPPPPP 667 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 35.9 bits (79), Expect = 0.042 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PP P PP G A PPP Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPP 318 Score = 35.5 bits (78), Expect = 0.056 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP 651 PPPP G PPPPPPP P Sbjct: 303 PPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 32.3 bits (70), Expect = 0.52 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPP PP G A PPP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPP 305 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.056 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F S PPPP PPPP PP A PPP Sbjct: 45 FISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 31.5 bits (68), Expect = 0.91 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP A P P Sbjct: 75 PPPP---AAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 586 PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PPPP PP P A PPP Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPP 77 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PP P PQ PP Sbjct: 85 PPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.5 bits (78), Expect = 0.056 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 Q PPPP PPPPPPP PP Sbjct: 462 QAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 34.7 bits (76), Expect = 0.098 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 34.7 bits (76), Expect = 0.098 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 33.1 bits (72), Expect = 0.30 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 464 PPPPP-------PPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 31.9 bits (69), Expect = 0.69 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 598 GGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G PPPPPPP PP PPP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPP-PPQXXXTP 651 G G A PPPP PPPPP PP TP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 34.7 bits (76), Expect = 0.098 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTP-PXAXGGXXAXPPP 690 A S K PP P PPPPPPP TP A G PPP Sbjct: 261 ASSSSKGHPPIPSASQNATPPPPPPPPS--NTPGMFASSGFQPPPPP 305 Score = 31.9 bits (69), Expect = 0.69 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 G F S PPPP PPPP P PP Sbjct: 292 GMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 31.5 bits (68), Expect = 0.91 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXX-----PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP PP PPP Sbjct: 284 PPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 311 PPPPPPEPTSELPPPPPPP 329 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S+ + P PP PPPP Q PP G PPP Sbjct: 303 SRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 345 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP---PPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPP P Q PP PP G Sbjct: 206 PPPPERSSG--PPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPG 246 Score = 31.9 bits (69), Expect = 0.69 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 616 PPPPPPQXXXTPPXAXGGXXAXPP 687 PPPPPP PP A G PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 31.5 bits (68), Expect = 0.91 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G SQ+ PPP G P P PPP PP G PP Sbjct: 221 GRGPSQRSLAPPPT---GSSRPLPAPPPGENRPPPPMRGPTSGGEPP 264 Score = 31.5 bits (68), Expect = 0.91 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPP---PPQXXXT---PPXAXGGXXAXPPP 690 GG K PPPP G PPPPP PP T PP A PP Sbjct: 260 GGEPPPPKNAPPPPKR--GSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPP 311 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = -3 Query: 554 APPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFX 375 APPPP + P F PP P P F G PP Sbjct: 146 APPPPDRGGQLAKKP-SQGSFPPPPPM--GKPPPPSGNKPTFGNSRTSTNGPPPPPHSRH 202 Query: 374 XGXPPPPPXGGXPP 333 PPPP PP Sbjct: 203 GSAPPPPERSSGPP 216 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = -1 Query: 514 RPXXXXFXPPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXP 335 +P F PPP P P K F PPP PPPP P Sbjct: 159 KPSQGSFPPPPPMGKPPP---PSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGP 215 Query: 334 P 332 P Sbjct: 216 P 216 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S + PPPP PPPPP PP PPP Sbjct: 352 STRSAPPPPPGRAPQPLGGPPPPPP-GRRPPSGKINPPPPPPP 393 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP 332 PPP G PPPPP G PP Sbjct: 359 PPPGRAPQPLGGPPPPPPGRRPP 381 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPP-----PPPPQXXXTPPXAXGGXXAXPPPXG 696 G + S PPPP G PPP PPPP P PPP G Sbjct: 185 GNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPP----PPGRGPSQRSLAPPPTG 235 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP+ PP G PPP G Sbjct: 250 PPPPMR--GPTSGGEPPPPKN-APPPPKRGSSNPPPPPTRG 287 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPP P G PPP G Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRG 256 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 S++ PPPP G PPP PP + PP PPP G Sbjct: 551 SEEPPPPPP----GVDIPPPLPPSEDPKPPPPPPEPPEECPPPPPG 592 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXA 678 PPP PPPPPP PP G A Sbjct: 564 PPPLPPSEDPKPPPPPPEPPEECPPPPPGDEMA 596 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S+ + P PP PPPP Q PP G PPP Sbjct: 215 SRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 257 Score = 32.7 bits (71), Expect = 0.39 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP---PPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPP P Q PP PP G Sbjct: 118 PPPPERSSG--PPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPG 158 Score = 31.5 bits (68), Expect = 0.91 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G SQ+ PPP G P P PPP PP G PP Sbjct: 133 GRGPSQRSLAPPPT---GSSRPLPAPPPGENRPPPPMRGPTSGGEPP 176 Score = 31.5 bits (68), Expect = 0.91 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPP---PPQXXXT---PPXAXGGXXAXPPP 690 GG K PPPP G PPPPP PP T PP A PP Sbjct: 172 GGEPPPPKNAPPPPKR--GSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPP 223 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = -3 Query: 554 APPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFX 375 APPPP + P F PP P P F G PP Sbjct: 58 APPPPDRGGQLAKKP-SQGSFPPPPPM--GKPPPPSGNKPTFGNSRTSTNGPPPPPHSRH 114 Query: 374 XGXPPPPPXGGXPP 333 PPPP PP Sbjct: 115 GSAPPPPERSSGPP 128 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = -1 Query: 514 RPXXXXFXPPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXP 335 +P F PPP P P K F PPP PPPP P Sbjct: 71 KPSQGSFPPPPPMGKPPP---PSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGP 127 Query: 334 P 332 P Sbjct: 128 P 128 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S + PPPP PPPPP PP PPP Sbjct: 264 STRSAPPPPPGRAPQPLGGPPPPPP-GRRPPSGKINPPPPPPP 305 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP 332 PPP G PPPPP G PP Sbjct: 271 PPPGRAPQPLGGPPPPPPGRRPP 293 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPP-----PPPPQXXXTPPXAXGGXXAXPPPXG 696 G + S PPPP G PPP PPPP P PPP G Sbjct: 97 GNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPP----PPGRGPSQRSLAPPPTG 147 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP+ PP G PPP G Sbjct: 162 PPPPMR--GPTSGGEPPPPKN-APPPPKRGSSNPPPPPTRG 199 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPP P G PPP G Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRG 168 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG +GGGGGGG GGGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 31.9 bits (69), Expect = 0.69 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAP 549 GGG GG GGGGGGG GGGG + + P Sbjct: 104 GGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGGCYEIQIEP 150 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 686 GGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFF 567 GG GG GGGG GG GGGG F+ Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFY 131 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 34.3 bits (75), Expect = 0.13 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPPP Sbjct: 758 PPPPAVPGEGARPPPPPPP 776 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPP Sbjct: 757 PPPPPAVPGEGARPPPPPP 775 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP A G A PPP Sbjct: 755 PPPPPPP--------AVPGEGARPPP 772 Score = 23.4 bits (48), Expect(2) = 1.9 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 PP G P PPPPP Sbjct: 712 PPLSSTLGPPPPAPPPPP 729 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP------PXAXGGXXAXP 684 PPPP PP PPPPQ P P A GG A P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKP 136 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 SQ PPPP PPPPPPP +PP PP Sbjct: 199 SQITQPPPPPPRPPPSPPPPPPPPS--PSPPRPPPPPPPSPP 238 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP +PP PPP Sbjct: 215 PPPPPPPPSPSPPRPPPPPP--PSPPRPLAAKLPEPPP 250 Score = 31.9 bits (69), Expect = 0.69 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 7/48 (14%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT-------PPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP PP PPP G Sbjct: 217 PPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLG 264 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P P PPP PPP PP PPP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG A GG GGGGGGG GGGG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG A G GGGGGGG GGGG Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGG 579 GGG GG GGGGGGG GGG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGG G GGGG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGG GGG GGGG Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGGG GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGG GGGG Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGG GG GGGG Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGG 579 GGG GG GGGGGGG GGG Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 32.3 bits (70), Expect = 0.52 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 G G S+ + P P PPPPPPP PP + G Sbjct: 849 GRGRGRSRYRRPRPRPRRPPPPPPPPPPPPPPPPPPPASSTG 890 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 ++ PPPP PPPPPP + P Sbjct: 865 RRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTP 651 ++ PPPP PPPPP TP Sbjct: 865 RRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPPPPP PP P G Sbjct: 868 PPPPPPPPPPPPPPPPPPASSTGSTPGG 895 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.9 bits (69), Expect = 0.69 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXG--GXXXPPPPPPPQXXXTPPXAX--GGXXAXPPP 690 G + SQ PP P PP PPPP PP G A PPP Sbjct: 154 GPSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 577 PPPPXXXGGXXXPP---PPPPPQXXXTPPXAXGGXXA 678 PPPP PP PP P PP GG A Sbjct: 181 PPPPGAPAAPPAPPFGGPPSAPPPPPAPPVGGGGSLA 217 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 31.9 bits (69), Expect = 0.69 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPP PPPPPPPQ P G Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQG 453 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 PPPP PPPPPP P G Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQG 453 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPPPP PP A P P G Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALPDPLQG 453 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 31.9 bits (69), Expect = 0.69 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP+ P G PP G Sbjct: 794 PPPPP-------PPPPPPPEDLIIPLPRRGSDLFAPPADKG 827 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPP 633 ++ + P GG PPPPPPP Sbjct: 778 NESRYKPEGEGVGGITPPPPPPPP 801 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 31.9 bits (69), Expect = 0.69 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 601 GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G PPP PPP TPP PPP Sbjct: 426 GTATPPPTPPPTPPPTPPPTTLPPTTQPPP 455 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 31.9 bits (69), Expect = 0.69 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPP----PPPQXXXTPPXAXGG--XXAXPPPXG 696 GGG PPPP G PPPP PPP+ PP PPP G Sbjct: 448 GGGPPQLPPNLPPPPGGMRG--MPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRG 502 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP---PP---PPQXXXTPPXAXGGXXAXPPPXGG 699 + PPPP G PP P PPQ P GG PPP G Sbjct: 426 RLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMG 474 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 31.9 bits (69), Expect = 0.69 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGGG GGGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 31.9 bits (69), Expect = 0.69 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGGG GGGG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 31.9 bits (69), Expect = 0.69 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGGG GGGG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 686 GGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GG GGGGGGG GGGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGGG GG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGGG G GG Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGGG GG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GG GGGGGGG GGGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 G G GG GGGGGGG GGGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 31.5 bits (68), Expect = 0.91 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ 636 PPPP PPPPPPP+ Sbjct: 199 PPPPLDDLDDLPPPPPPPPE 218 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGG 669 PPPPPPP PP GG Sbjct: 68 PPPPPPPPPPLPPPPPSGG 86 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGG 669 PPPPPPP PP GG Sbjct: 292 PPPPPPPPPPLPPPPPSGG 310 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP PPP P + + P G + PPP G Sbjct: 2140 PPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMG 2178 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 686 GGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG A GG+ GGGGGG GGGG Sbjct: 66 GGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 613 PPPPPPPQXXXTP 651 PPPPPPPQ P Sbjct: 459 PPPPPPPQMYQQP 471 Score = 22.2 bits (45), Expect(2) = 1.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 601 GXXXPPPPPP 630 G PPPPPP Sbjct: 456 GPPPPPPPPP 465 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP G PPP PP TPP PP Sbjct: 122 PPPPPT--GTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 7/44 (15%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-------PPPQXXXTPPXAXGGXXAXPP 687 PPP G PPPP PP + T P G + PP Sbjct: 132 PPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ 636 PPPP PPPPPPP+ Sbjct: 66 PPPPRRGFYDDYPPPPPPPR 85 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP G PPPPPP Sbjct: 65 PPPPPRRGFYDDYPPPPPP 83 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPP 630 ++ PPPP PPPPPP Sbjct: 48 ERPPPPPPPRFYDNDIPPPPPP 69 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP G PPP PP PP A G PPP Sbjct: 179 PPPAPPGVLAPPPAPP--GVLPPPPAPPGALIPPPP 212 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP 630 PPPP G PPP PP Sbjct: 198 PPPPAPPGALIPPPPAPP 215 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXA 660 PPP G PPPP PP PP A Sbjct: 189 PPPAPPG--VLPPPPAPPGALIPPPPA 213 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 PPP G PPPP PP Sbjct: 198 PPPPAPPGALIPPPPAPP 215 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 Q++ PP P G P PPP Q PP Sbjct: 420 QRQSPPQPSPTGAPPQRPHPPPQQPSPRPP 449 >SB_39066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +1 Query: 577 PPPPXXXG--GXXXPPPPP-PPQXXXTP-PXAXGGXXAXPPPXGG 699 P PP G G PP PP PP TP P A PP GG Sbjct: 270 PGPPGVRGRRGKRGPPGPPGPPNGGATPHPGAMPTPSGEPPDKGG 314 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 583 PPXXXGGXXXPPPP--PPPQXXXTPP---XAXGGXXAXPPPXG 696 PP G PPPP PPPQ PP PPP G Sbjct: 383 PPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIG 425 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.9 bits (64), Expect = 2.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP 630 PPPP PPPPPP Sbjct: 85 PPPPPPASNVPAPPPPPP 102 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPP Sbjct: 84 PPPPPPPASNVPAPPPPPP 102 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP P PPPPP Sbjct: 83 PPPPPPPPASNVPAPPPPP 101 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPP 687 PPP P PPPPPQ T PP A PP Sbjct: 570 PPPEFSDLESSAPIPPPPPQMNNTSAPPPPNKEKQTAKPP 609 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPPXGGXPP 332 GG PPP G PPP P GG PP Sbjct: 272 GGMPPP-------GMPPPMPPGGMPP 290 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP PP G PPP Sbjct: 241 PPPPHSMPPPGMPPPGMMPPPGF---PPMGMPGMGGMPPP 277 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 29.9 bits (64), Expect = 2.8 Identities = 23/89 (25%), Positives = 23/89 (25%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXXXXXRQQKKFXX 756 PPPP P PPP Q PP PP K Sbjct: 307 PPPPAASEPAAFAPAPPPSQ-APPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMS 365 Query: 757 XXXHRXXPXXGRXGGGXXXXXAPPPPXKK 843 R P R G PPPP K Sbjct: 366 TPVQR--PPGMRPPGAGNGPGGPPPPWSK 392 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXP--PPPPPPQXXXT---PPXAXGGXXAXPPPXG 696 PPPP G P PPP PP PP PPP G Sbjct: 386 PPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPG 430 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP 630 PPPP PPPPPP Sbjct: 425 PPPPPGFPQFQPPPPPPP 442 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-PPPPPQXXXTPP 654 PPPP PP PPPPP T P Sbjct: 908 PPPPLPLAPEPPPPLPPPPPPIQTTRP 934 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPPP PPPPPPP TP G Sbjct: 1311 PPPPPPP-----PPPPPPPPLPPTPNVEDSG 1336 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 F + PPPP PPPP P + +PP G PPP Sbjct: 505 FVEDRSPPPPPPAS-----PPPPLPAEEDNSPPPLPAG----PPP 540 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 F PPPP P PPPP PP A PP Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPP 131 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PP PPP PP PP Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPP PPPP PP PPP Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 1/27 (3%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP-PPPPQXXXTPP 654 PP P PPP PPPP PP Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPP 190 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PP PP A PPP Sbjct: 149 PPPP----NPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP P PPPP PP PPP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PP Sbjct: 175 PPPPYPP--PPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Score = 28.3 bits (60), Expect = 8.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P PP PPP Sbjct: 204 PPPP----NPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 G + PPPP PPPPPPP + P Sbjct: 45 GDDYDDDHDPPPPPPPP--PPPPPPPPPPSSSPSRP 78 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXP 684 PPPPPPP PP + P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 A Q+K P P PPPP PP A PPP Sbjct: 203 AAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 P PP PPPPPPP Sbjct: 231 PAPPPPPAAAPPPPPPPPP 249 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -3 Query: 686 GGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAP 549 GG GG GGG GGG GGGG F + P Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARP 133 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 P GG P P P PP GG PP GG Sbjct: 571 PDHRTTGGYPAPTPSYPQPGTYPPPHPSGGYPQPSPPHGG 610 >SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) Length = 641 Score = 25.8 bits (54), Expect(2) = 4.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPP 633 PP PPPPPPP Sbjct: 343 PPIMSVADMIPPPPPPP 359 Score = 21.8 bits (44), Expect(2) = 4.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 616 PPPPPPQXXXTP 651 PPPPPP P Sbjct: 353 PPPPPPPGEGPP 364 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP G PP PP PQ PP G PP Sbjct: 102 PPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P G P PP PQ PP G PP Sbjct: 272 PPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 309 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P G P PP PQ PP G PP Sbjct: 357 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 394 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P G P PP PQ PP G PP Sbjct: 442 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 479 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P G P PP PQ PP G PP Sbjct: 527 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 564 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGG 579 GGG GG WGG GG G GGG Sbjct: 144 GGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGG 612 GGG GGV GGGGGGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGG 105 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = -3 Query: 407 GGXPPXXXXFXXGXPPP---PPXGGXPP 333 GG PP + G PPP P GG PP Sbjct: 56 GGYPPPQPGYAGGPPPPGIAPGIGGPPP 83 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPPXA 660 P GG PPPPPPP PP A Sbjct: 125 PRAPPGGPGAPPPPPPP--AVVPPSA 148 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPP---PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP P GG PPPPP PP A G A PPP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPP-----PPGA--GDPAYPPP 242 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGG GGG GGGG Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGGG GGGG Sbjct: 76 GGGGGGGGDDGDGG-GGDGGGGGGGGDGGGGGGGGGGG 112 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGG 91 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGG GG GGGG Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 28.7 bits (61), Expect = 6.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPP 630 G + S PPPP G PPPPP Sbjct: 917 GSTDSLDSLPLPPPPPELLGSDADLPPPPP 946 Score = 25.4 bits (53), Expect(2) = 5.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 P G PPPPPPP Sbjct: 875 PGSPPTGADDFPPPPPPP 892 Score = 21.8 bits (44), Expect(2) = 5.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 616 PPPPPPQXXXTP 651 PPPPPP P Sbjct: 886 PPPPPPPVMKKP 897 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.7 bits (61), Expect = 6.4 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 6/32 (18%) Frame = +1 Query: 613 PPPPPPPQXXXTP------PXAXGGXXAXPPP 690 PPPPPPP TP P G PPP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPP 808 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXA 660 PPPPPPP PP A Sbjct: 80 PPPPPPPPPPPPPPGA 95 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 PPP PPPPPPP Sbjct: 73 PPPLCAPPPPPPPPPPPP 90 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PP PPPP Sbjct: 9 PPPPPIAAEFTAPPAPPPP 27 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 28.7 bits (61), Expect = 6.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 P PP PPPPP PP G PPP G Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMG---LPPPPPG 1258 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXA 660 PPPPPPP PP A Sbjct: 281 PPPPPPPPPPPPPPGA 296 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 PPP PPPPPPP Sbjct: 274 PPPLCAPPPPPPPPPPPP 291 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.7 bits (61), Expect = 6.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P P PPPPPPP P PPP Sbjct: 876 PGSPSVKPAIDWPPPPPPPATSNGDPSLLLTTNVPPPP 913 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 601 GXXXPPPPPPPQXXXTPP 654 G PPPPPPP PP Sbjct: 207 GDAKPPPPPPPPPPPPPP 224 >SB_46953| Best HMM Match : DUF1014 (HMM E-Value=0.83) Length = 284 Score = 25.4 bits (53), Expect(2) = 7.7 Identities = 11/21 (52%), Positives = 11/21 (52%), Gaps = 2/21 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPP--PPPPP 633 P P GG PP PPPPP Sbjct: 214 PNSPTHRGGDRDPPTTPPPPP 234 Score = 21.4 bits (43), Expect(2) = 7.7 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +1 Query: 613 PPPPPPPQ 636 PPPPPP + Sbjct: 230 PPPPPPSE 237 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGG 157 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 665 PXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFF 567 P GG WG GGGGG G G + Sbjct: 225 PGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHY 257 >SB_55307| Best HMM Match : HEAT (HMM E-Value=2.4e-11) Length = 1552 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PP P G P PPPPP Sbjct: 1227 PPTPIEVDGIDSPSPPPPP 1245 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP 651 PPPP PPPPPPP TP Sbjct: 378 PPPP--------PPPPPPPAPGSTP 394 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 24.2 bits (50), Expect(2) = 8.8 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +1 Query: 613 PPPPPPPQ 636 PPPPPPP+ Sbjct: 912 PPPPPPPR 919 Score = 22.2 bits (45), Expect(2) = 8.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 601 GXXXPPPPPP 630 G PPPPPP Sbjct: 909 GRKPPPPPPP 918 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,515,509 Number of Sequences: 59808 Number of extensions: 375191 Number of successful extensions: 5430 Number of sequences better than 10.0: 80 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3302 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2455286845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -