BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_B01 (862 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 44 1e-04 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 44 1e-04 At1g61080.1 68414.m06877 proline-rich family protein 40 0.002 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 40 0.003 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 40 0.003 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 40 0.003 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 39 0.004 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 39 0.005 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 38 0.007 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 38 0.011 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 37 0.020 At4g18570.1 68417.m02749 proline-rich family protein common fami... 36 0.026 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 36 0.026 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 36 0.035 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 36 0.046 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 36 0.046 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 36 0.046 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 36 0.046 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 35 0.061 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 35 0.061 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 35 0.080 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 35 0.080 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 34 0.11 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 34 0.11 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 34 0.11 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 34 0.11 At1g75550.1 68414.m08780 glycine-rich protein 34 0.11 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 31 0.12 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 28 0.12 At4g22770.1 68417.m03287 DNA-binding family protein contains a A... 34 0.14 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 33 0.18 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 33 0.18 At3g13140.1 68416.m01644 hydroxyproline-rich glycoprotein family... 33 0.18 At1g62240.1 68414.m07021 expressed protein 33 0.18 At1g15830.1 68414.m01900 expressed protein 33 0.18 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 33 0.18 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 33 0.24 At1g63830.2 68414.m07224 proline-rich family protein contains pr... 33 0.24 At1g63830.1 68414.m07223 proline-rich family protein contains pr... 33 0.24 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 33 0.32 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.32 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 33 0.32 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 33 0.32 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 33 0.32 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 33 0.32 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 33 0.32 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 29 0.34 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 26 0.36 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 26 0.36 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 31 0.36 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 32 0.43 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 32 0.43 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 32 0.43 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 32 0.43 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 28 0.54 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 26 0.55 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 32 0.56 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 32 0.56 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 32 0.56 At4g33660.1 68417.m04781 expressed protein 32 0.56 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 32 0.56 At3g18810.1 68416.m02389 protein kinase family protein contains ... 32 0.56 At3g05545.1 68416.m00609 transcription factor, putative / zinc f... 32 0.56 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 32 0.56 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 32 0.56 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 31 0.75 At3g24540.1 68416.m03082 protein kinase family protein contains ... 31 0.75 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 31 0.75 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 31 0.75 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 31 0.75 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 31 0.75 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 25 0.76 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 0.99 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 31 0.99 At3g28630.2 68416.m03574 expressed protein contains Pfam profil... 31 0.99 At3g28630.1 68416.m03573 expressed protein contains Pfam profil... 31 0.99 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 31 0.99 At2g17770.1 68415.m02058 ABA-responsive element binding protein,... 31 0.99 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 0.99 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 31 1.3 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 27 1.6 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 27 1.6 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 30 1.7 At1g26150.1 68414.m03192 protein kinase family protein similar t... 30 1.7 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 30 2.3 At4g01985.1 68417.m00265 expressed protein 30 2.3 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 30 2.3 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 30 2.3 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 30 2.3 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 30 2.3 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 30 2.3 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 30 2.3 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 25 2.7 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 3.0 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 29 3.0 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 29 3.0 At3g50180.1 68416.m05486 hypothetical protein 29 3.0 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 29 3.0 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 29 3.0 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 29 3.0 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 29 3.0 At1g02710.1 68414.m00222 glycine-rich protein 29 3.0 At5g46730.1 68418.m05757 glycine-rich protein 29 4.0 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 29 4.0 At5g38560.1 68418.m04662 protein kinase family protein contains ... 29 4.0 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 29 4.0 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 29 4.0 At4g08230.1 68417.m01358 glycine-rich protein 29 4.0 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 4.0 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 4.0 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 29 4.0 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 29 4.0 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 29 4.0 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 29 4.0 At1g29380.1 68414.m03592 hypothetical protein 29 4.0 At1g12380.1 68414.m01431 expressed protein 29 4.0 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 29 4.0 At2g48160.1 68415.m06031 PWWP domain-containing protein 26 4.3 At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family pr... 25 4.8 At5g56140.1 68418.m07003 KH domain-containing protein 29 5.3 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 5.3 At4g21720.1 68417.m03145 expressed protein 29 5.3 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 5.3 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 29 5.3 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 29 5.3 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 29 5.3 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 29 5.3 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 29 5.3 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 29 5.3 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 29 5.3 At2g05440.2 68415.m00575 glycine-rich protein 29 5.3 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 29 5.3 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 29 5.3 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 5.3 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 28 7.0 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 28 7.0 At5g24620.1 68418.m02908 thaumatin-like protein, putative simila... 28 7.0 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 28 7.0 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 28 7.0 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 28 7.0 At3g29060.1 68416.m03635 EXS family protein / ERD1/XPR1/SYG1 fam... 28 7.0 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 28 7.0 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 28 7.0 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 28 7.0 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 28 7.0 At2g35270.1 68415.m04326 DNA-binding protein-related contains Pf... 28 7.0 At2g30560.1 68415.m03722 glycine-rich protein 28 7.0 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 28 7.0 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 28 7.0 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 28 7.0 At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family... 28 7.0 At1g15840.1 68414.m01901 expressed protein 28 7.0 At1g21500.1 68414.m02689 expressed protein 24 7.0 At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chlor... 26 7.5 At3g51290.1 68416.m05614 proline-rich family protein 25 7.6 At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK... 24 7.7 At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family pr... 26 8.2 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 28 9.2 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 28 9.2 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 28 9.2 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 28 9.2 At4g36260.1 68417.m05157 zinc finger protein-related similar to ... 28 9.2 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 28 9.2 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 28 9.2 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 28 9.2 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 28 9.2 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 28 9.2 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 28 9.2 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 28 9.2 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 28 9.2 At1g27710.1 68414.m03387 glycine-rich protein 28 9.2 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/50 (44%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXT-------PPXAXGGXXAXPPPXG 696 KK PPPP G PPPPPPPQ + PP + G PPP G Sbjct: 191 KKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPPPG 240 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPP---PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP +PP PPP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPP---PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP +PP PPP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPP---PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP +PP PPP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPP---PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP +PP PPP Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPPP +PP PPP Sbjct: 54 PPPPVNLS--PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPP---PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP +PP PPP Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP + PPP Sbjct: 144 PPPPVLLS---PPPPPVLFSPPPPTVTRPPPPPTITRSPPPP 182 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = +1 Query: 547 GGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 GG + PP GG PPPPPPP PP GG PPP G Sbjct: 660 GGGKSTNLPSARPPLPGGG---PPPPPPPPGGGPPPPPGGGPPPPPPPPG 706 Score = 35.9 bits (79), Expect = 0.035 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 407 GGXPPXXXXFXXGXPPPPPXGGXPP 333 GG PP G PPPPP GG PP Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPP 700 Score = 35.5 bits (78), Expect = 0.046 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 409 GGXPPPXXXFFXXGXPPPPPXGGXPP 332 GG PPP G PPPPP GG PP Sbjct: 677 GGPPPPPPP--PGGGPPPPPGGGPPP 700 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 PPPP GG PPP P PP A G Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPPGALG 709 Score = 33.1 bits (72), Expect = 0.24 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP GG PP PPPPP A GG P Sbjct: 681 PPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGGNKVHRAP 722 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 727 PPLXGGXXXSPPXGGXGPXPPP 662 PP GG PP GG P PPP Sbjct: 683 PPPPGGGPPPPPGGGPPPPPPP 704 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = -1 Query: 727 PPLXGG-XXXSPPXGGXGPXPPP 662 PPL GG PP G GP PPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPP 694 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGG 579 PP GG PP GG GGG PP G G Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRG 711 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 659 PGGGXGPXPPXXGGXXXXXXXXXXXXNKKNXYPRPPTAPXXXXGXGGGG 805 PGGG P PP GG P PP P G G GG Sbjct: 675 PGGGPPPPPPPPGGGPPPPPGGG---------PPPPPPPPGALGRGAGG 714 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 727 PPLXGGXXXSPPXGGXGPXPPP 662 PP G PP GG P PPP Sbjct: 682 PPPPPGGGPPPPPGGGPPPPPP 703 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP G A PPP Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPP 564 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/101 (27%), Positives = 30/101 (29%), Gaps = 6/101 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP----QXXXTPPXAXG--GXXAXPPPXGGXXXXXXXXXXXRQ 738 PPPP G PPPPPPP + PP G G PPP Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPP 609 Query: 739 QKKFXXXXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRPR 861 P R G PPPP RP+ Sbjct: 610 PPMAMANGAAGPPPPPPRMGMANGAAGPPPPPGAARSLRPK 650 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT--PPXAXGGXXAXPPP 690 PPPP PPPPPPP+ PP G A PPP Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP Q PP P P Sbjct: 540 PPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSP 577 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 10/48 (20%) Frame = +1 Query: 577 PPPPXXXG-----GXXXPPPPPPP-----QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP PP A PPP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPP 539 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 8/60 (13%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXT-----PPXAXG---GXXAXPPPXG 696 G G+ PP P G PPPPP PP G G PPP G Sbjct: 583 GNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPPG 642 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP P A PPP Sbjct: 461 PPPPAVMPLKHFAPPPPPPLPPAVMPLK---HFAPPPP 495 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 +Q PPPP P PPP P GG PPP Sbjct: 558 TQAAPPPPPPPPMQNRAPSPPPMPMGN----SGSGGPPPPPPP 596 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPP P A PPP Sbjct: 440 PPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPP 477 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PP P G PPPPP P+ PP G A PP G Sbjct: 390 PPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSG 429 Score = 31.9 bits (69), Expect = 0.56 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXG---GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP GG PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPP----APPPGSGGPKPPPPP 406 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 P P G PPP PPP PP G PPP Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 727 PPLXGGXXXSPPXGGXGPXPPP 662 PP GG PP G GP PPP Sbjct: 394 PPGSGGPKPPPPPGPKGPRPPP 415 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PP P G PPPPP P+ PP G A PP G Sbjct: 390 PPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSG 429 Score = 31.9 bits (69), Expect = 0.56 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXG---GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP GG PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPP----APPPGSGGPKPPPPP 406 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP-QXXXTPPXAXGGXXAXPPP 690 P P G PPP PPP PP G PPP Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 727 PPLXGGXXXSPPXGGXGPXPPP 662 PP GG PP G GP PPP Sbjct: 394 PPGSGGPKPPPPPGPKGPRPPP 415 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 +F PPPP PPPPPPP PP + PPP Sbjct: 371 SFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S PPPP PPPPPPP PP PPP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 33.1 bits (72), Expect = 0.24 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP P + PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP---PQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP P PP PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 31.5 bits (68), Expect = 0.75 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 414 PPPPPSPPPYVYPPPPPP--YVYPPPPSPPYVYPPPPP 449 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPP P PP PP Sbjct: 402 PPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPP PP PP Sbjct: 413 PPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP P PPP Sbjct: 401 PPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PP + PP Sbjct: 426 PPPPPPY---VYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP +PP PPP Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPPPP +PP PP Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP +PP PPP Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPP--SPPPPPPP 493 Score = 37.1 bits (82), Expect = 0.015 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP P P Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 35.9 bits (79), Expect = 0.035 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 35.9 bits (79), Expect = 0.035 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P + PPP Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 34.7 bits (76), Expect = 0.080 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P + PPP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPP 524 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 426 PPPPSPPPPVYSPPPPPPP-----PPPVYSPPPPPPPP 458 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP P PPP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP PP Sbjct: 475 PPPPVYSPPPPSPPPPPPPVYSPPPP 500 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP +PP PPP Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPP--PPPPPPP 508 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP P + PPP Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPP 472 Score = 31.9 bits (69), Expect = 0.56 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP +PP + PPP Sbjct: 619 PPPPPCI--EYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 Score = 31.5 bits (68), Expect = 0.75 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P +PP PP Sbjct: 539 PPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPP 576 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PPP Sbjct: 629 PPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP------PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPPP +PP + PPP Sbjct: 631 PPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPP 674 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP-----PPPPQ-XXXTPPXAXGGXXAXPPP 690 PPPP PPP PPPP+ +PP + + PPP Sbjct: 652 PPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPP 695 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXP-----PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP P+ P G A PPP Sbjct: 714 PPPPMVHHSPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPP 756 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXP--PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP +PP PPP Sbjct: 575 PPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 472 PPPPPPPVYSPPPPSPPPP-----PPPVYSPPPPPPPP 504 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PPP Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 7/45 (15%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQX-------XXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PPP Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXP-----PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPPP PP PPP Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPP 633 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP + PPP Sbjct: 609 PPPPPP---CIEPPPPPPCIEYSPPPPPPVVHYSSPPP 643 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P P + PPP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPPP P + PPP Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPP 603 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP PPPPP +PP A + PPP Sbjct: 682 PPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPP 717 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPP PP PP Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP 513 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP P PPP Sbjct: 501 PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPP 542 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP + PPP Sbjct: 642 PPPPVYYSS----PPPPPVYYSSPPPPPPVHYSSPPPP 675 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PPPP TPP PPP Sbjct: 408 PSPPPPAPIFSTPPTLTSPPPPSPPP 433 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/45 (28%), Positives = 16/45 (35%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + ++ PPP PPPP P PP PPP Sbjct: 533 YCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP 577 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +1 Query: 577 PPPPXXXGGXXX---PPPPP---PPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP +PP + PPP Sbjct: 522 PPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPP 565 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP +PP PPP Sbjct: 581 PPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPP 622 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXX-----PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP PPP Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPX--GGXPPXXFFFFSP 308 PPP PPPPP PP ++ SP Sbjct: 629 PPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSP 661 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 + PPPP PPPPPPP+ PP PP Sbjct: 262 RSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 33.1 bits (72), Expect = 0.24 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP PPPPPP PP PP G Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKG 303 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPP P PPPPP+ PP G Sbjct: 273 PPPQPPPPPPPKPQPPPPPKIARPPPAPPKG 303 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP G PPPPP PP PPP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 G F + P PP PPPPPP PP A PPP Sbjct: 364 GQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPP 410 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAX--GGXXAXPPP 690 PPPP PPPPPP + PP G A PPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP 423 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP--QXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPPPPPP + PP P P G Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPG 437 Score = 36.3 bits (80), Expect = 0.026 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPPPP + PP PP G Sbjct: 397 PPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPG 437 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP P PPPP PP G PPP G Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPG 415 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 568 KKXP--PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 KK P PPP G PPPPP P G P G Sbjct: 402 KKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPTKSG 446 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S K PPPP PPPPPPP + A PPP Sbjct: 32 SYKYSPPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP 627 PPPP G PPPPP Sbjct: 70 PPPPPSKYGRVYPPPPP 86 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 36.7 bits (81), Expect = 0.020 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT-----PPXAXGGXXAXPPPXGG 699 PPPP PPP PP + PP GG PPP GG Sbjct: 55 PPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGG 100 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPP-PPPPQXXXTPPXAXGGXXAXPPP 690 GGG ++ PPP GG PPP Q PP G PPP Sbjct: 75 GGGSSYY----YPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSGNYPTPPPP 121 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 36.3 bits (80), Expect = 0.026 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 ++ + PPP PPPPPPP PP A PPP Sbjct: 297 TENRADPPPQK--SIPPPPPPPPPPLLQQPPPPPSVSKAPPPP 337 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S + PP PPPPPPP PP PPP Sbjct: 296 STENRADPPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPP 338 Score = 33.5 bits (73), Expect = 0.18 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 QK PPPP PPPPPP PP + PPP Sbjct: 306 QKSIPPPP--------PPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 32.7 bits (71), Expect = 0.32 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQ 636 ++ PPPP PPPPPPP+ Sbjct: 322 QQPPPPPSVSKAPPPPPPPPPPK 344 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 36.3 bits (80), Expect = 0.026 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXX--PPPPPPPQXXXTPPXAXGGXXAXPPP 690 F K P P G PPPPPPP PP G PPP Sbjct: 210 FKPTKPEPNKPQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPPP 256 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP-PPXGG 699 PPPP PPPPPP PP P PP GG Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMPPAGG 271 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P G PPPPPP Q PP G PPP Sbjct: 220 PQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 Q + PPPP G PPPPP P GG Sbjct: 239 QAQPPPPP--PSGLFPPPPPPMANNGFRPMPPAGG 271 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 PPPP G PPPPPP P G P Sbjct: 242 PPPPPPSG--LFPPPPPPMANNGFRPMPPAGGFGHP 275 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 35.9 bits (79), Expect = 0.035 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + + PPP Sbjct: 328 KSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPP 373 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 88 KSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPP 133 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 108 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPP 153 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 128 KSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 173 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 148 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 193 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 168 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 213 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 188 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 233 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 208 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 253 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 228 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 273 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 248 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 293 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 268 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 313 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 288 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 333 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 368 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 413 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 388 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 433 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 61 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPP 103 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 81 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPP 123 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 101 PPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP 143 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 121 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPP 163 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 141 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 183 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 161 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 203 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 181 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 223 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 201 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 243 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 221 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 263 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 241 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 283 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 261 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 303 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 281 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 323 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 301 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP 343 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 381 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 423 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 401 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 443 Score = 31.9 bits (69), Expect = 0.56 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP P PPPPP +PP + PPP Sbjct: 348 KSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 393 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/61 (26%), Positives = 21/61 (34%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPPXXFFFFS 311 PPP P P+ K + PPP + PPP PP + + S Sbjct: 51 PPPPYVYSSPPPPPYIYKSPP-PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKS 109 Query: 310 P 308 P Sbjct: 110 P 110 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP +PP + PPP Sbjct: 51 PPPPYVYSS-----PPPPPYIYKSPPPPPYVYSSPPPP 83 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 65 YIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSP-PPPPYVYSSPPPP 123 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 124 PYVYKSPPPPPYVYNSPPPPPYVYKSP 150 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/61 (26%), Positives = 21/61 (34%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPPXXFFFFS 311 PPP P P+ K + PPP + PPP PP + + S Sbjct: 71 PPPPYVYSSPPPPPYIYKSPP-PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKS 129 Query: 310 P 308 P Sbjct: 130 P 130 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 125 YVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPP 183 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 184 PYVYKSPPPPPYVYSSPPPPPYVYKSP 210 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 185 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPP 243 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 244 PYVYKSPPPPPYVYSSPPPPPYVYKSP 270 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 245 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPP 303 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 304 PYVYKSPPPPPYVYSSPPPPPYVYKSP 330 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 325 YVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSP-PPPPYVYSSPPPP 383 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 384 PYVYKSPPPPPYVYSSPPPPPYVYKSP 410 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 91 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYNSPPPPPYVY 147 Query: 316 FSP 308 SP Sbjct: 148 KSP 150 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 167 Query: 316 FSP 308 SP Sbjct: 168 KSP 170 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/82 (21%), Positives = 23/82 (28%) Frame = -3 Query: 554 APPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFX 375 +PPPP K P PP P P + PP + Sbjct: 119 SPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYS 178 Query: 374 XGXPPPPPXGGXPPXXFFFFFP 309 PPP PP + + P Sbjct: 179 SPPPPPYVYKSPPPPPYVYSSP 200 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 187 Query: 316 FSP 308 SP Sbjct: 188 KSP 190 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 151 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 207 Query: 316 FSP 308 SP Sbjct: 208 KSP 210 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 171 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 227 Query: 316 FSP 308 SP Sbjct: 228 KSP 230 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/82 (21%), Positives = 23/82 (28%) Frame = -3 Query: 554 APPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFX 375 +PPPP K P PP P P + PP + Sbjct: 179 SPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYS 238 Query: 374 XGXPPPPPXGGXPPXXFFFFFP 309 PPP PP + + P Sbjct: 239 SPPPPPYVYKSPPPPPYVYSSP 260 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 247 Query: 316 FSP 308 SP Sbjct: 248 KSP 250 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 211 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 267 Query: 316 FSP 308 SP Sbjct: 268 KSP 270 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 231 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 287 Query: 316 FSP 308 SP Sbjct: 288 KSP 290 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/82 (21%), Positives = 23/82 (28%) Frame = -3 Query: 554 APPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFX 375 +PPPP K P PP P P + PP + Sbjct: 239 SPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYS 298 Query: 374 XGXPPPPPXGGXPPXXFFFFFP 309 PPP PP + + P Sbjct: 299 SPPPPPYVYKSPPPPPYVYSSP 320 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 251 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 307 Query: 316 FSP 308 SP Sbjct: 308 KSP 310 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 271 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 327 Query: 316 FSP 308 SP Sbjct: 328 KSP 330 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 291 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYNSPPPPPYVY 347 Query: 316 FSP 308 SP Sbjct: 348 KSP 350 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 305 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSP-PPPPYVYSSPPPS 363 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 364 PYVYKSPPPPPYVYSSPPPPPYVYKSP 390 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 311 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVY---KSPPPPPYVYSSPPPSPYVY 367 Query: 316 FSP 308 SP Sbjct: 368 KSP 370 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/61 (26%), Positives = 21/61 (34%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPPXXFFFFS 311 PPP P P+ K + PPP + PPP PP + + S Sbjct: 331 PPPPYVYNSPPPPPYVYKSPP-PPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKS 389 Query: 310 P 308 P Sbjct: 390 P 390 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 351 PPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 407 Query: 316 FSP 308 SP Sbjct: 408 KSP 410 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 371 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 427 Query: 316 FSP 308 SP Sbjct: 428 KSP 430 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 391 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 447 Query: 316 FSP 308 SP Sbjct: 448 KSP 450 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 6/47 (12%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPP-QXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP PP PPP Sbjct: 408 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPP 454 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/82 (21%), Positives = 23/82 (28%) Frame = -3 Query: 554 APPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFX 375 +PPPP K P PP P P + PP + Sbjct: 59 SPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYS 118 Query: 374 XGXPPPPPXGGXPPXXFFFFFP 309 PPP PP + + P Sbjct: 119 SPPPPPYVYKSPPPPPYVYNSP 140 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPPPP PP PPP Sbjct: 308 KSPPPPPYVYSS----PPPPPYVYKSPPPPPYVYNSPPPPP 344 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 8/49 (16%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXG---GXXAXPPP 690 K PPPP PP P PPP +PP + PPP Sbjct: 428 KSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPP 476 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPPPP PP PPP Sbjct: 68 KSPPPPPYVYSS----PPPPPYIYKSPPPPPYVYSSPPPPP 104 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 35.5 bits (78), Expect = 0.046 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PP PP A PPP Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP--PPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPP PPP PP A PPP Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPP +PP A A PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP 95 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PP P + A PPP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 35.5 bits (78), Expect = 0.046 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PP PP A PPP Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP--PPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPP PPP PP A PPP Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPP +PP A A PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP 95 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PP P + A PPP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPP 102 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 35.5 bits (78), Expect = 0.046 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP G PPP Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 Q PPPP PPPPPPP G PP Sbjct: 40 QSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPP 654 PP PPPPPPP PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPP 58 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPP 654 PP PPPPPPP PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPP 59 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 35.5 bits (78), Expect = 0.046 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG---GXXAXPPPXG 696 PPPP PPPPP PP G G + PPP G Sbjct: 715 PPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLG 757 Score = 34.7 bits (76), Expect = 0.080 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPPP + G PPP Sbjct: 646 PPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPP 683 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT---PPXAXGGXXAXPPPXG 696 PP P PPPPPPP T PP PPP G Sbjct: 702 PPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPG 744 Score = 33.5 bits (73), Expect = 0.18 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXX-----PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPPP P A PPP Sbjct: 622 PPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPP 664 Score = 33.1 bits (72), Expect = 0.24 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPPPP P PP A PPP Sbjct: 570 KTPPPPP-------PPPPPLPSRSIPPPLAQPPPPRPPPP 602 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP G PPPPPP PP PPP G Sbjct: 705 PPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPG 744 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + PPP PPPPPPP + P PPP Sbjct: 585 RSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP PPPPPPP P + PPP G Sbjct: 594 PPPPRPP-----PPPPPPPSSRSIPSPSAPPPPPPPPPSFG 629 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP G + PPP Sbjct: 645 PPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPP 682 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXG----GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP T + PPP Sbjct: 509 PPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPP 550 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXT--PPXAXGGXXAXPPP 690 S+ PPPP PPPP + + PP G A PPP Sbjct: 723 SKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPP 767 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXG----GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP T PPP Sbjct: 604 PPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPP 645 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP PPPPPPP T + PPP Sbjct: 471 PPSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPP 508 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP--PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPP PP + P P Sbjct: 576 PPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSP 615 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 6/44 (13%) Frame = +1 Query: 577 PPPPXXXG------GXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP T + PPP Sbjct: 488 PPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP T + PPP Sbjct: 485 PPPPPPPLFTSTTSFSPSQPPPPPPP 510 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPP G PP PP PP A PP Sbjct: 663 PPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPP 699 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPP 630 PPP G PPPPPP Sbjct: 753 PPPLGAKGSNAPPPPPP 769 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG----XXAXPPP 690 PPPP P PPPP PP + G A PPP Sbjct: 603 PPPPPSSRSIPSPSAPPPP---PPPPPSFGSTGNKRQAQPPP 641 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/38 (31%), Positives = 12/38 (31%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PP P G PPP Sbjct: 683 PPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPP 720 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 35.1 bits (77), Expect = 0.061 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPP-PPPPQXXXTPPXAXGGXXAXPPPXGG 699 Q PPPP GG PPP PPQ P PPP G Sbjct: 279 QNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYG 324 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP GG PPPP Q PP G PPP G Sbjct: 262 PPPPHMGGS-APPPPHMGQNYGPPPPNNMGGPRHPPPYG 299 Score = 31.9 bits (69), Expect = 0.56 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP G PPPPP PP G A PPP G Sbjct: 241 PPPQRPPMGG---PPPPPHIGGSAPPPPHMGGSAPPPPHMG 278 Score = 28.7 bits (61), Expect = 5.3 Identities = 32/131 (24%), Positives = 37/131 (28%), Gaps = 12/131 (9%) Frame = +1 Query: 313 KKKKKXXGGXPPXGGGGGXPXKKXXXXGGXPPXKKXXXKXLXXXKKG-XXGXXGXXKXGG 489 ++++ GG PP G P G PP G G GG Sbjct: 232 RRRENMAGGPPPQRPPMGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGG 291 Query: 490 XKXXXXXGXXFFFXXXXGGGGAFXSQKKXPPPPXXXGG------XXXPPPP-----PPPQ 636 + G GG Q PP GG PPP PPPQ Sbjct: 292 PRHPPPYGA----PPQNNMGGPRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYGGGPPPQ 347 Query: 637 XXXTPPXAXGG 669 PP GG Sbjct: 348 YGAVPPPQYGG 358 Score = 28.7 bits (61), Expect = 5.3 Identities = 26/94 (27%), Positives = 27/94 (28%) Frame = -3 Query: 614 GXXXPPXXXGGGGXFFXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXX 435 G PP GG APPPP P + PP P P Sbjct: 249 GGPPPPPHIGGS--------APPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGA 300 Query: 434 XFFXXXFXXGGXPPXXXXFXXGXPPPPPXGGXPP 333 G PP G PPP GG PP Sbjct: 301 P--PQNNMGGPRPPQ----NYGGTPPPNYGGAPP 328 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 108 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP 153 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 198 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 243 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 218 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 263 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 238 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 283 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 258 KSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP 303 Score = 35.1 bits (77), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 278 KSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP 323 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP PPP Sbjct: 128 KSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPP 173 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP +PP + PPP Sbjct: 158 KSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPP 203 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 71 PPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPP 113 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 81 PPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 123 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 91 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 133 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 181 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 223 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 291 PPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPP 333 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 301 PPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPP 343 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 101 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 143 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 121 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP 163 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 171 PPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 213 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 191 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 233 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 211 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 253 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 231 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 273 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 251 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 293 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP 313 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP PPP Sbjct: 311 PPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPP 353 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 580 PPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PP PPPPP +PP + PPP Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPP 103 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/82 (21%), Positives = 23/82 (28%) Frame = -3 Query: 554 APPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFX 375 +PPPP K P PP P P + PP + Sbjct: 249 SPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYS 308 Query: 374 XGXPPPPPXGGXPPXXFFFFFP 309 PPP PP + + P Sbjct: 309 SPPPPPYVYKSPPPPPYVYTSP 330 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 261 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---SSPPPPPYVYSSPPPPPYVY 317 Query: 316 FSP 308 SP Sbjct: 318 KSP 320 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 91 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 147 Query: 316 FSP 308 SP Sbjct: 148 SSP 150 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/74 (25%), Positives = 22/74 (29%) Frame = -3 Query: 554 APPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFX 375 +PPPP K P PP P P + PP + Sbjct: 99 SPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYK 158 Query: 374 XGXPPPPPXGGXPP 333 PPPPP PP Sbjct: 159 --SPPPPPYVYSPP 170 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 195 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPP 253 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 254 PYVYKSPPPPPYVYSSPPPPPYVYKSP 280 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 297 Query: 316 FSP 308 SP Sbjct: 298 SSP 300 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/61 (27%), Positives = 21/61 (34%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPPXXFFFFS 311 PPP P P+ K PPP + PPPP PP + +S Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY--SSPPPPPYVYKSPPPPPYVYS 168 Query: 310 P 308 P Sbjct: 169 P 169 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/61 (26%), Positives = 21/61 (34%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPPXXFFFFS 311 PPP P P+ K + PPP + PPP PP + + S Sbjct: 141 PPPPYVYSSPPPPPYVYKSPP-PPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKS 199 Query: 310 P 308 P Sbjct: 200 P 200 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 155 YVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSP-PPPPYVYSSPPPP 213 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 214 PYVYKSPPPPPYVYSSPPPPPYVYKSP 240 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 181 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 237 Query: 316 FSP 308 SP Sbjct: 238 KSP 240 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/63 (28%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPX--GGXPPXXFFF 317 PPP P P+ K PPP + PPPPP PP + + Sbjct: 201 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY---KSPPPPPYVYSSPPPPPYVY 257 Query: 316 FSP 308 SP Sbjct: 258 KSP 260 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 255 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSP-PPPPYVYSSPPPP 313 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 314 PYVYKSPPPPPYVYTSPPPPPYVYKSP 340 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/87 (20%), Positives = 24/87 (27%) Frame = -3 Query: 569 FXXKKAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPX 390 + K PPPP P PP P P+ + PP Sbjct: 105 YVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSP-PPPPYVYKSPPPP 163 Query: 389 XXXFXXGXPPPPPXGGXPPXXFFFFFP 309 + PPP PP + + P Sbjct: 164 PYVYSPPPPPPYVYQSPPPPPYVYSSP 190 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 34.7 bits (76), Expect = 0.080 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP 630 PPPP GG PPPPPP Sbjct: 640 PPPPSMSGGAPPPPPPPP 657 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 586 PXXXGGXXXPPPPPPPQXXXTP-PXAXGGXXAXPPP 690 P G PPPPPPP P P G PPP Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPP 50 Score = 29.9 bits (64), Expect = 2.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPP 633 ++ P P G PPPPPPP Sbjct: 32 RRSAPSPPPMSGRVPPPPPPPP 53 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP PPPPP + +PP G PPP Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPP 51 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPP 630 ++ P PP G PPPPPP Sbjct: 32 RRSAPSPPPMSGRVPPPPPPPP 53 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -1 Query: 406 GXPPPXXXFFXXGXPPPPP 350 G PPP G PPPPP Sbjct: 696 GAPPPTLPSMSGGAPPPPP 714 >At2g23770.1 68415.m02839 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein contains Pfam domains, PF00069: Protein kinase domain and PF01476: LysM domain Length = 612 Score = 34.7 bits (76), Expect = 0.080 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PP PPPPPPPQ PP + G Sbjct: 236 PPANTNSLIPPPPPPPPQSVSPPPLSPDG 264 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP----QXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP + PP A PPP Sbjct: 18 PPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPP 59 Score = 31.1 bits (67), Expect = 0.99 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPP 633 ++ PPPP PPPPPPP Sbjct: 40 RRAPPPPPPPLMRRRAPPPPPPP 62 Score = 31.1 bits (67), Expect = 0.99 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 45 PPPPPLMRRRAPPPPPPPP 63 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTP 651 +++ PPPP PPPPPP P Sbjct: 39 RRRAPPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPP PPPPP P+ PP Sbjct: 47 PPPLMRRRAPPPPPPPPLPRPCSRPP 72 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 7/48 (14%) Frame = +1 Query: 577 PPPPXXXGGXXX---PPPP----PPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP PPPQ PP G PP GG Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGG 214 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 Q+ PPP GG PPPPP PP G PP GG Sbjct: 205 QRPMIPPP---GGMMRGPPPPPHGMQGPPPPRPG----MPPAPGG 242 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPP Q PP GG PPP Sbjct: 190 PPPQQFSG---PPPPQYGQRPMIPP--PGGMMRGPPP 221 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 7/48 (14%) Frame = +1 Query: 577 PPPPXXXGGXXX---PPPP----PPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP PPPQ PP G PP GG Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGG 214 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 Q+ PPP GG PPPPP PP G PP GG Sbjct: 205 QRPMIPPP---GGMMRGPPPPPHGMQGPPPPRPG----MPPAPGG 242 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G PPPP Q PP GG PPP Sbjct: 190 PPPQQFSG---PPPPQYGQRPMIPP--PGGMMRGPPP 221 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPP-PPPPQXXXTPPXAXGGXXAXPPP 690 GGGG++ PPPP GG PPP PP G PPP Sbjct: 60 GGGGSYYYS---PPPPSSSGGVKYPPPYGGDGYGGYYPPPYYGNYGTPPPP 107 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 S PPPP GG PP PP + GG PPP GG Sbjct: 48 SYSPPPPPPSSSGGGGSYYYSPP------PPSSSGG-VKYPPPYGG 86 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGG 579 GGG GG WGGGGGGG GGG Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 32.7 bits (71), Expect = 0.32 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWG-GGGGGGXXXPPXXXGGGG 576 GGG GG WG GGGGGG GGGG Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 31.9 bits (69), Expect = 0.56 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 G WGGGGGGG GGGG Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGG 88 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGGXFF 567 GG GGGGGGG GGGG ++ Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGGGWY 105 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 653 GGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GGGGGGG GGGG Sbjct: 74 GGGGGGGGGGGGGGGGGGGWGWGGGG 99 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 31.1 bits (67), Expect(2) = 0.12 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 34 PPPPPSHQPYSYPPPPPPP 52 Score = 30.7 bits (66), Expect(2) = 0.15 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 35 PPPPSHQPYSYPPPPPPPP 53 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPP Q PP Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPP 47 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPPP P PP + PPP Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP 49 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ--XXXTPPXAXGGXXAXPPP 690 PP P PPPPPP PP + PPP Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPP 48 Score = 21.8 bits (44), Expect(2) = 0.12 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 616 PPPPPPQXXXTP 651 PPPPPP P Sbjct: 72 PPPPPPPSAPPP 83 Score = 21.8 bits (44), Expect(2) = 0.15 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 619 PPPPPQXXXTPP 654 PPPPP PP Sbjct: 72 PPPPPPPSAPPP 83 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 27.9 bits (59), Expect(2) = 0.12 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP T A P P Sbjct: 238 PPPPPPPPPSPTTAAKRNADPAQPSP 263 Score = 25.0 bits (52), Expect(2) = 0.12 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 601 GXXXPPPPPPP 633 G PPPPPPP Sbjct: 236 GPPPPPPPPPP 246 >At4g22770.1 68417.m03287 DNA-binding family protein contains a AT hook motif (DNA binding motifs with a preference for A/T rich regions), Pfam:PF02178 Length = 334 Score = 33.9 bits (74), Expect = 0.14 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXP 684 PPPPPPPQ TP A G + P Sbjct: 47 PPPPPPPQNSFTPSAAMDGFSSGP 70 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP + PPP Sbjct: 693 PPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPP 730 Score = 31.5 bits (68), Expect = 0.75 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 P PP PPPPPPP PP Sbjct: 715 PAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 PP P PPPPPPP P + G Sbjct: 717 PPTPIVHTSSPPPPPPPPPPPAPPTPQSNG 746 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/75 (24%), Positives = 18/75 (24%) Frame = -3 Query: 557 KAPPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXF 378 K PPPP P PP P P P P Sbjct: 705 KVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLP 764 Query: 377 XXGXPPPPPXGGXPP 333 PPPP PP Sbjct: 765 THSASPPPPTAPPPP 779 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQ 636 PPPP PPPPPP+ Sbjct: 777 PPPPLGQTRAPSAPPPPPPK 796 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP G P PPPP + G P P Sbjct: 776 PPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTP 812 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 33.5 bits (73), Expect = 0.18 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPP---PPPQXXXTPPXAXGGXXAXPPP 690 K PPP PPPP PPP TPP + PPP Sbjct: 91 KPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXA--XPPP 690 PPPP PPPP P TPP A PPP Sbjct: 32 PPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPP 71 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PP--PPXXXGGXXXPP---PPPPPQXXXTPPXAXGGXXAXPPP 690 PP PP PP PPPPP PP A + PPP Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPP 127 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPPP 690 P PP PP PPPPPQ PP A P P Sbjct: 51 PQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKP 92 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP--PPQXXXTPPXAXGGXXAXPP 687 PPPP PPPP PP T P A PP Sbjct: 112 PPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPP 150 >At3g13140.1 68416.m01644 hydroxyproline-rich glycoprotein family protein Length = 183 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 G A+ S + PPPP GG PP PP+ P A P Sbjct: 102 GNYAYPSLYQYPPPPHVYGGNYAHPPSNPPRHSEAPRQATNPHTTPP 148 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFF 567 G G A GG+ GGGGGGG G G FF Sbjct: 78 GNGNAHGRADCPGGIVVGGGGGGGGGGGGGGGSGGSNGSFF 118 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 33.5 bits (73), Expect = 0.18 Identities = 26/105 (24%), Positives = 31/105 (29%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXX 723 GGG + PPP GG P PPP+ G PPP G Sbjct: 128 GGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPG---APPPKRGGGGEPVIP 184 Query: 724 XXXRQQKKFXXXXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRP 858 ++ P R GGG PPP + P Sbjct: 185 GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEP 229 Score = 32.3 bits (70), Expect = 0.43 Identities = 26/105 (24%), Positives = 30/105 (28%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXXX 723 GGG PPP G P PPP + P G PPP G Sbjct: 97 GGGGEPVIPGAPPPNRGGGETVIPGAPPPIRGGGGEPAIPGA----PPPKRGGGGEPVIP 152 Query: 724 XXXRQQKKFXXXXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRP 858 ++ P R GGG PPP + P Sbjct: 153 GAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEP 197 Score = 31.9 bits (69), Expect = 0.56 Identities = 26/100 (26%), Positives = 30/100 (30%), Gaps = 1/100 (1%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXX-PPPPPPPQXXXTPPXAXGGXXAXPPPXGGXXXXXXX 720 GGG PPP GG P PPP + P G PPP G Sbjct: 160 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGA----PPPKRGGGGEPVI 215 Query: 721 XXXXRQQKKFXXXXXHRXXPXXGRXGGGXXXXXAPPPPXK 840 ++ P R GGG PPP + Sbjct: 216 PGAPPPKRGGGGEPVIPGAPLPKRGGGGESVVPGAPPPKR 255 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG A G GGG GGG GGGG Sbjct: 385 GGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGG 422 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PP PPPP+ PP PPP Sbjct: 55 PPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 33.1 bits (72), Expect = 0.24 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPPQ P + PPP Sbjct: 63 PPPPQT------PPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P P P P+ PP + PPP Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPP 106 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPPXXFFFFSP 308 PPP + PPP P PP F SP Sbjct: 92 PPPYHHYITPSPPPPRPLPPPPPPPLHFSSP 122 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 5/55 (9%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPP-----PPPPQXXXTPPXAXGGXXAXPPP 690 GGG + P P PPP PPPP PP PPP Sbjct: 39 GGGSDSTNYNSPAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 >At1g63830.2 68414.m07224 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains 1 predicted transmembrane domain Length = 232 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 G F SQ PP P PPP PP A G A PP G Sbjct: 180 GVFGSQPMGVPPAQQMSRFDQPVPPPVGYPQSYPPPAQGYPPASYPPPG 228 >At1g63830.1 68414.m07223 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains 1 predicted transmembrane domain Length = 232 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 550 GAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 G F SQ PP P PPP PP A G A PP G Sbjct: 180 GVFGSQPMGVPPAQQMSRFDQPVPPPVGYPQSYPPPAQGYPPASYPPPG 228 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 32.7 bits (71), Expect = 0.32 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP 651 PPPP PPPPPPP P Sbjct: 29 PPPPPMRRRAPLPPPPPPPMRRRAP 53 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP PP PPP Sbjct: 27 PPPPPPPMRRRAPLPPPPP-----PPMRRRAPLPPPPP 59 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 586 PXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P G PPPPPPP PP PPP Sbjct: 15 PPMRGRVPLPPPPPPP----PPPMRRRAPLPPPPP 45 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP 630 PPPP PPPPPP Sbjct: 43 PPPPPMRRRAPLPPPPPP 60 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP P PPPPP PP + PPP Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPP 738 Score = 31.9 bits (69), Expect = 0.56 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP PP +PP + PPP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP 804 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP P PP PPP Sbjct: 758 PPPPPTV--HYNPPPPPSPAHYSPPPSPPVYYYNSPPP 793 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP--XXFFFFSP 308 PPP ++ PPPPP PP + + SP Sbjct: 703 PPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISP 735 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPP PP PPP Sbjct: 745 PPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPP 781 Score = 29.5 bits (63), Expect = 3.0 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP------PPPPQXXXTP-PXAXGGXXAXPPP 690 PPPP PPP PPPP P P G A PPP Sbjct: 791 PPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPP 835 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPP PP PPP Sbjct: 779 PPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP + PPP Sbjct: 801 PPPPPVI--HHSQPPPPPIYEGPLPPIPGISYASPPPP 836 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP +PP + PPP Sbjct: 66 PPPPYVYNS----PPPPPPYIYNSPPRPPYVYKSPPPP 99 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 77 PPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPP 119 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPP------PPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP PPPPP + P + PPP Sbjct: 94 KSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPP 139 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/61 (27%), Positives = 20/61 (32%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPPXXFFFFS 311 PPP P P+ K F PPP + PPP P F + S Sbjct: 77 PPPPYIYNSPPRPPYVYKSPP-PPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSS 135 Query: 310 P 308 P Sbjct: 136 P 136 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPPP + A + PPP Sbjct: 256 PPPPIKKGSSPSPPPPPPVKKV----GALSSSASKPPP 289 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 8/45 (17%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPP--------PQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPP P PP G + PPP Sbjct: 227 PPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPP 271 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP-PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPP PP P G Sbjct: 69 PPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPPG 108 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K P PP P PPP PQ PP A P P Sbjct: 37 KPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 Q K PPP PPP P P +PP PP G Sbjct: 76 QPKPAPPPEPKPA---PPPAPKPVPCPSPPKPPAPTPKPVPPHG 116 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PP PPP+ P A A PP Sbjct: 101 PPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 32.7 bits (71), Expect = 0.32 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP----QXXXTPPXAXGGXXAXPPP 690 PPPP G PPPPP P + PP G A PPP Sbjct: 224 PPPP---GRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPP 262 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 +K PP G PPPPP P A G A PPP G Sbjct: 243 RKGVAAPPLPPPGTAALPPPPP-----LPMAAGKGVAAPPPPPPG 282 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 PPPP PPPPP P TPP G Sbjct: 300 PPPPP-------PPPPPQPLIAATPPRKQG 322 Score = 27.1 bits (57), Expect(2) = 0.34 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPP 633 K PP PPPPPPP Sbjct: 240 KPSSPPQQPPATPPPPPPPPP 260 Score = 24.2 bits (50), Expect(2) = 0.34 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 613 PPPPPPPQXXXTPP 654 PPP PPP PP Sbjct: 296 PPPSPPPPPPPPPP 309 >At5g46780.2 68418.m05763 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 25.8 bits (54), Expect(2) = 0.36 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXA 660 PPPPPPP + P A Sbjct: 102 PPPPPPPPPVQSVPIA 117 Score = 25.4 bits (53), Expect(2) = 0.36 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPP 633 K P P PPPPPPP Sbjct: 89 KVRPAPLTQLNHPPPPPPPPPP 110 >At5g46780.1 68418.m05762 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 25.8 bits (54), Expect(2) = 0.36 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXA 660 PPPPPPP + P A Sbjct: 102 PPPPPPPPPVQSVPIA 117 Score = 25.4 bits (53), Expect(2) = 0.36 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPP 633 K P P PPPPPPP Sbjct: 89 KVRPAPLTQLNHPPPPPPPPPP 110 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +1 Query: 613 PPPPPPPQXXXTPP---XAXGGXXAXPPP 690 PPPPPPP TPP G PPP Sbjct: 154 PPPPPPPPPTITPPVTTTTTGHHHHRPPP 182 Score = 29.9 bits (64), Expect(2) = 0.36 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 613 PPPPPPPQXXXTPP 654 PPPPPPP TPP Sbjct: 123 PPPPPPPPPTITPP 136 Score = 21.4 bits (43), Expect(2) = 0.36 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 P G PPPPPP Sbjct: 85 PATTNSGHHQLRPPPPPP 102 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 32.3 bits (70), Expect = 0.43 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT 648 PPPP PPPPPPP T Sbjct: 51 PPPPLYFSYFSLPPPPPPPHLPPT 74 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP 332 PPP F PPPPP PP Sbjct: 51 PPPPLYFSYFSLPPPPPPPHLPP 73 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 379 FXXGXPPPPPXGGXPPXXFFFFS 311 F PPPPP PP F +FS Sbjct: 39 FFLPHPPPPPPPPPPPLYFSYFS 61 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 32.3 bits (70), Expect = 0.43 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 7/50 (14%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXX---PPPPPPPQXXXTPPXAXG----GXXAXPPP 690 S + PPPP PPPPPPP+ +PP A PPP Sbjct: 481 SFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPP 530 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPP---PQXXXTPP 654 + +Q PPPP PPPPPP P +PP Sbjct: 613 YATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPP 648 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPP-----PQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP PP A PPP Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPP 649 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S + PPPP PP PPPP +PP + PPP Sbjct: 523 SVRAYPPPPPL---SPPPPSPPPPYIYSSPPPP---SPSPPPP 559 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP-PPPPQXXXTPP 654 PPPP P P PPPP +PP Sbjct: 540 PPPPYIYSSPPPPSPSPPPPYIYSSPP 566 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPP Sbjct: 662 PPPPVYYSPVTQSPPPPPP 680 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPPXGGXPP 332 PPP ++ PPPPP PP Sbjct: 620 PPPPPTYYAVQSPPPPPPVYYPP 642 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/73 (24%), Positives = 22/73 (30%) Frame = -3 Query: 551 PPPPXXXXKKKXXPXXXXXFXPPXXXXPXXPXXPFXXXXXFFXXXFXXGGXPPXXXXFXX 372 PPPP + P + PP P P ++ PP Sbjct: 620 PPPPPTYYAVQSPPPPPPVYYPPVTASPPPP-------PVYYTPVIQSPPPPPVYYSPVT 672 Query: 371 GXPPPPPXGGXPP 333 PPPPP PP Sbjct: 673 QSPPPPPPVYYPP 685 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 32.3 bits (70), Expect = 0.43 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 544 GGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GGG + P P PPPPPPP P PPP Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPP 87 Score = 31.9 bits (69), Expect = 0.56 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PP PPPP +PP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP PP PPP Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 GGG P P PPPPPPP P + PP Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPP 87 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PP PPP +PP + PPP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPP P PP A P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPP PPP PP P P Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 GG P P PPPPPP +PP P P Sbjct: 40 GGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSP 89 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 32.3 bits (70), Expect = 0.43 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP+ P Sbjct: 247 PPPPIPVKQSATPPPPPPPKLKNNGP 272 Score = 31.1 bits (67), Expect = 0.99 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP P PPPPP T + PP G Sbjct: 260 PPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAPRG 300 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPP P G PPP Sbjct: 246 PPPPPIPVKQSATPPPPPP-----PKLKNNGPSPPPPP 278 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP + PPP Sbjct: 245 PPPPPPIPVKQSATPPPPP-----PPKLKNNGPSPPPP 277 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 27.9 bits (59), Expect(2) = 0.71 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 553 AFXSQKKXPP-PPXXXGGXXXPPPPPPP 633 A S PP PP PPPPPPP Sbjct: 616 ALSSSPLPPPLPPKKLLATTNPPPPPPP 643 Score = 25.8 bits (54), Expect(2) = 0.54 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPPPPP + A PP Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPP 625 Score = 24.6 bits (51), Expect(2) = 0.54 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPP 633 A S P P PPPPPPP Sbjct: 553 AVTSSPLPPLKPLRILSRPPPPPPPPP 579 Score = 22.2 bits (45), Expect(2) = 0.71 Identities = 11/29 (37%), Positives = 11/29 (37%), Gaps = 1/29 (3%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXP-PPXG 696 PP PPPP G P PP G Sbjct: 663 PPVPPPPAPAPLSRSHNGNIPPVPGPPLG 691 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 26.2 bits (55), Expect(2) = 0.55 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPPQ G PPP Sbjct: 429 PPPPPPPQQLQV-----AGINKTPPP 449 Score = 24.2 bits (50), Expect(2) = 0.55 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPP 633 S K P PPPPPPP Sbjct: 411 SSSKTSFPINVPNSQPRPPPPPPP 434 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.9 bits (69), Expect = 0.56 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +1 Query: 562 SQKKXP-PPPXXXGGXXXPPPPPPPQXXXTPP 654 +Q+K P PPP PPPPPP PP Sbjct: 360 TQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPP 391 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPP PPPPPPP PP Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPP 392 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 31.9 bits (69), Expect = 0.56 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 556 FXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 + S PPPP PPPPP PP + PPP Sbjct: 47 YRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 67 PPPPPIYS---PPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 31.9 bits (69), Expect = 0.56 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT 648 PPPP PPPPPPP T Sbjct: 1110 PPPPPLSPPPSPPPPPPPPSQSLT 1133 Score = 31.5 bits (68), Expect = 0.75 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 Q+ PP P P PP PP PP A PPP Sbjct: 1066 QESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPP 1107 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXT 648 PPPP PPPPPP Q T Sbjct: 1111 PPPPLSPPPSPPPPPPPPSQSLTT 1134 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PP +PP + PPP Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSPPPSP--PPPPPPP 1128 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP--PPPQXXXTPP 654 PPPP PPPP PPP PP Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPP 1119 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 31.9 bits (69), Expect = 0.56 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP 651 PPPP PPPPPPP P Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXG 666 PPP PPPPPP PP G Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPPPPRKVG 48 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 31.9 bits (69), Expect = 0.56 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP P PPPPP PP Sbjct: 11 PPPPPPPSFRSIPRPPPPPSFRSIPP 36 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = -1 Query: 400 PPPXXXFFXXGXPPPPP-XGGXPPXXFFF 317 PPP F PPPPP PP FF Sbjct: 13 PPPPPSFRSIPRPPPPPSFRSIPPRRHFF 41 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 31.9 bits (69), Expect = 0.56 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 267 PPPPPPGSWQPSPPPPPPP 285 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/46 (28%), Positives = 16/46 (34%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 +Q++ PPP P PPPP P PP G Sbjct: 24 NQQQSSPPPSDSSSPSPPAPPPPDDSSNGSPQPPSSDSQSPPSPQG 69 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPP 630 G G PPPP PPPPPP Sbjct: 256 GSNGNNNWMNSPPPPPPGSWQPSPPPPPPP 285 >At3g05545.1 68416.m00609 transcription factor, putative / zinc finger (C3HC4 type RING finger) family protein similar to VIP2 protein [Avena fatua] gi|6996144|emb|CAB75506; contains Pfam domain PF00097: Zinc finger, C3HC4 type (RING finger) Length = 425 Score = 31.9 bits (69), Expect = 0.56 Identities = 25/97 (25%), Positives = 27/97 (27%), Gaps = 2/97 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG-XXAXPPPXGGXXXXXXXXXXXRQQKKFX 753 P P G PPPPPPPQ G PPP R + Sbjct: 220 PVDPHYHGWDYHPPPPPPPQHFSASGAHVGSPTQPTPPPAAARTSRANGSDMIRPRPPHF 279 Query: 754 XXXXHRXXPXXGRXGGGXXXXXAPPP-PXKKXKXRPR 861 H GR G PP P + R R Sbjct: 280 TRPFH-GHSSSGRAGSSVASVPRTPPFPGSNARTRDR 315 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 31.9 bits (69), Expect = 0.56 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -3 Query: 695 PXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 P GG + PP GG GGGGG P GGGG Sbjct: 406 PSPGGGSGSPPSTGGGSGSPPSTGGGGG---SPSKGGGGG 442 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGG 615 PP GG + PP GG GGGGG Sbjct: 415 PPSTGGGSGSPPSTGGGGGSPSKGGGGG 442 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 31.9 bits (69), Expect = 0.56 Identities = 19/71 (26%), Positives = 25/71 (35%) Frame = -1 Query: 520 KXRPXXXXFXPPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGG 341 K P + PPP P P P+ + PPP + PPPP Sbjct: 448 KMSPSVRAYPPPPPPSPSPPP--PYVYSSPPPPYVYSSPPPPP---YVYSSPPPPPYVYS 502 Query: 340 XPPXXFFFFSP 308 PP + + SP Sbjct: 503 SPPPPYVYSSP 513 Score = 31.9 bits (69), Expect = 0.56 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP-PPPPQXXXTPP 654 PPPP PPP PPPP +PP Sbjct: 513 PPPPYVYSSPPPPPPSPPPPCPESSPP 539 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP-----PPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP PPPP +PP PPP Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPP 526 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXP----PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP +PP + PPP Sbjct: 466 PPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP 507 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPPP +PP + PPP Sbjct: 475 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPY--VYSSPPP 515 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPP-----PPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPPP PP PPP Sbjct: 485 PPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPP 527 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP PP + PPP Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYYPPVT----PSPPPP 630 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP PP + PPP Sbjct: 612 PPPPSPLYYPPVTPSPPPPSPVYYPPVT----PSPPPP 645 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPP PP + PPP Sbjct: 627 PPPPSPVYYPPVTPSPPPPSPVYYPPVT----PSPPPP 660 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 S + PPPP P PPPP +PP PPP Sbjct: 452 SVRAYPPPPPPS------PSPPPPYVYSSPPPPYVYSSPPPPP 488 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 31.5 bits (68), Expect = 0.75 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 3/77 (3%) Frame = +3 Query: 333 GGXPPXGGGGGXPXXKXXXXGGGXPPXKXXXKKXXXXXKGXPXG---XXGXXXGGGKXXX 503 GG GGGG P GGG P G P G G GGG Sbjct: 341 GGKNGGKGGGGHPLDGKMGGGGGGPNGNKGG--GGVQMNGGPNGGKKGGGGGGGGGGGPM 398 Query: 504 XXGRXFFFXXXXGGGGG 554 G F GGGGG Sbjct: 399 SGGLPPGFRPMGGGGGG 415 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = -2 Query: 834 GGGGGPXXXTPPPPXPXXXXGAVGGRGXKFFLLXXXXXXXXXXPXPPXXGGXGPXP 667 GGGGGP PP G GG G + + P GG GP P Sbjct: 392 GGGGGPMSGGLPPGFRPMGGGGGGGGGPQSMSMPMGGAMGGPMGSLPQMGG-GPGP 446 Score = 28.3 bits (60), Expect = 7.0 Identities = 30/123 (24%), Positives = 30/123 (24%), Gaps = 1/123 (0%) Frame = +3 Query: 333 GGXPPXGGGGGXPXXKXXXXGGGXPPXKXXXKKXXXXXKGXPXGXXGXXXGGGKXXXXXG 512 GG GGGG GGG K G G GGG G Sbjct: 320 GGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGG 379 Query: 513 -RXFFFXXXXGGGGGFFXXKKXPPPPXXXXGXXXAXXXXXXXXXXXXXTXXGGGXGPXPP 689 GGGGG PP G GG G P Sbjct: 380 PNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGPQSMSMPMGGAMGGPMGSLPQ 439 Query: 690 XGG 698 GG Sbjct: 440 MGG 442 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG P G GGGGGGG GGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGG----GGGGGGG 139 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -3 Query: 689 GGGXAXXPPXAX-GGVXXXWGGGGGGGXXXPP 597 GGG A GG GGGGGGG PP Sbjct: 110 GGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 7/48 (14%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGG-------GGGXXXPPXXXGGGG 576 P GGG GG GGGG GGG P GGGG Sbjct: 326 PGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGG 373 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 31.5 bits (68), Expect = 0.75 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PPPPP + P G PP Sbjct: 58 PPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPP 94 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPP TPP G PPP Sbjct: 59 PPPKAPVNVSLSPPPPPRSPSTSTPPRL--GNRNPPPP 94 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 31.5 bits (68), Expect = 0.75 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPP PP PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPP P PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPP 89 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPP PPP P P G Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAFAVGKTPEG 105 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 31.5 bits (68), Expect = 0.75 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = -3 Query: 698 PPXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPP 543 P GGG GG +GGGGG GGGG F + PP Sbjct: 4 PMRGGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFGGFRDEGPP 55 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 Q PPP PPPPPPQ GG PPP Sbjct: 278 QHSMVPPPMQFRPPQGMPPPPPPQ-FLNHQQGFGGPRPPPPP 318 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 686 GGXAXXPPXAXGGVXXXWGGGGGGGXXXPP 597 GG P GG GGGGGGG PP Sbjct: 61 GGGKPPPHGGKGGGPPHHGGGGGGGGKSPP 90 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 632 GGGGGGGXXXPPXXXGGGG 576 GGGGGGG PP G GG Sbjct: 44 GGGGGGGSKPPPHHGGKGG 62 Score = 29.1 bits (62), Expect = 4.0 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = +3 Query: 297 PXXPGEKKKKXXGGXPPXGGGGGXPXXKXXXXGGGXPPXKXXXKKXXXXXKGXPXGXXGX 476 P P K + GG GGGG P GGG PP G P G Sbjct: 33 PHPPVPKPPQHGGG----GGGGSKPPPHHGGKGGGKPP-------PHGGKGGGPPHHGGG 81 Query: 477 XXGGGK 494 GGGK Sbjct: 82 GGGGGK 87 Score = 28.7 bits (61), Expect = 5.3 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 5/85 (5%) Frame = -3 Query: 689 GGGXAXXPPXA--XGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAP---PPPXXXXK 525 GGG P GG GG GGG PP GGGG K P PPP Sbjct: 48 GGGSKPPPHHGGKGGGKPPPHGGKGGG----PPHHGGGGGG--GGKSPPVVRPPPVVVRP 101 Query: 524 KKXXPXXXXXFXPPXXXXPXXPXXP 450 + PP P P Sbjct: 102 PPIIRPPPVVYPPPIVRPPPITRPP 126 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP GG PPP P GG PP GG Sbjct: 40 PPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGG 80 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 663 GGGXGPXPPXGGXXXXPPXRGG 728 G G G PP GG PP GG Sbjct: 59 GKGGGKPPPHGGKGGGPPHHGG 80 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +3 Query: 324 KXXGGXPPXGG-GGGXPXXKXXXXGGGXPP 410 K G PP GG GGG P GGG P Sbjct: 60 KGGGKPPPHGGKGGGPPHHGGGGGGGGKSP 89 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 25.0 bits (52), Expect(2) = 0.76 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGG 612 GGG GG +GG GGGG Sbjct: 254 GGGYGGGRSGGYGGYGGEFGGYGGGG 279 Score = 25.0 bits (52), Expect(2) = 0.76 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 629 GGGGGGXXXPPXXXGGGGXF 570 GGGGGG GGGG + Sbjct: 300 GGGGGGYNRGGYSMGGGGGY 319 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.1 bits (67), Expect = 0.99 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 102 PPPPPQPLNLFSPPPPPPP 120 Score = 31.1 bits (67), Expect = 0.99 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 103 PPPPQPLNLFSPPPPPPPP 121 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPPPP PP PP Sbjct: 550 PPPPPVYS----PPPPPPPVHSPPPPVFSPPPPVYSPP 583 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPP +PP + PPP Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP---PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 526 PPPPVY--SPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXP--PPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PPPPP PP + PP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXP--PPPPPPQXXXTPPXAXGGXXAXPPP 690 K+ PPP P PPPPP +PP + PPP Sbjct: 514 KRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPP---VHSPPPP 553 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP---PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 605 PPPPVHS---PPPPPPVYSPPPPVFSPPPSQSPPVVYSPPP 642 >At3g28630.2 68416.m03574 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 303 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQ 636 S+KK PP PPPPPPP+ Sbjct: 148 SRKKKAPPVAEPAYTPLPPPPPPPE 172 >At3g28630.1 68416.m03573 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 335 Score = 31.1 bits (67), Expect = 0.99 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQ 636 S+KK PP PPPPPPP+ Sbjct: 180 SRKKKAPPVAEPAYTPLPPPPPPPE 204 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP P+ P G A PPP Sbjct: 457 PPPPVHHSS----PPPPSPEFEGPLPPVIGVSYASPPP 490 >At2g17770.1 68415.m02058 ABA-responsive element binding protein, putative similar to ABA response element binding factor [Triticum aestivum] gi|21693583|gb|AAM75354 Length = 156 Score = 31.1 bits (67), Expect = 0.99 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP T A G PPP Sbjct: 48 PPPPPPPPSSSTIVTALYGSLPLPPP 73 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP---PPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP +PP + PPP Sbjct: 582 PPPPSPPPPVHSPPPPPVFSPPPPVFSPP-PPSPVYSPPPP 621 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PPP Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPP 589 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPP G PPPP + PP PPP G Sbjct: 508 PPPP---GEEWIPPPPSESEDVPPPPPDSYSEPIPPPPDNG 545 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 27.1 bits (57), Expect(2) = 1.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPPPPPQ P G P Sbjct: 61 PPPPPPPQWGPPSPHYPQGQPYSSP 85 Score = 21.8 bits (44), Expect(2) = 1.6 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 PPP PPPP P Sbjct: 6 PPPQYLRPPSGPPPPTDP 23 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 27.1 bits (57), Expect(2) = 1.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPP 687 PPPPPPPQ P G P Sbjct: 61 PPPPPPPQWGPPSPHYPQGQPYSSP 85 Score = 21.8 bits (44), Expect(2) = 1.6 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 PPP PPPP P Sbjct: 6 PPPQYLRPPSGPPPPTDP 23 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXX--TPPXAXGGXXAXPPPXGG 699 PPPP GG PP Q PP + G PPP G Sbjct: 67 PPPPSSSGGGPYYYYPPASQSGSYRPPPSSSSGGYYYPPPKSG 109 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 P PPPPP PP + PPP Sbjct: 45 PSPPPPPSNPSPPPPSPTTTACPPPP 70 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 P PP PPP P PP + GG Sbjct: 45 PSPPPPPSNPSPPPPSPTTTACPPPPSSSGG 75 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPP + T P PPP Sbjct: 124 PPPPPPTEAPPTTPITSPSPPTNPPP 149 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP P PPPP PP A + PPP Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPPA--NPVSSPPP 120 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPP P P PP PPP Sbjct: 44 PPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = -1 Query: 490 PPPXXXPXXPXGXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPP 332 PPP P P F + PPP + PPPPP PP Sbjct: 35 PPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPP 87 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 659 AXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 A GG+ GGGGGGG GGG Sbjct: 57 ASGGIGVGGGGGGGGGIGGSGGVGAGGG 84 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPP 633 PPPP PPPPPPP Sbjct: 14 PPPPRLLVLPPLPPPPPPP 32 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 6/39 (15%) Frame = +1 Query: 553 AFXSQKKXPPPP------XXXGGXXXPPPPPPPQXXXTP 651 A S+++ PPPP PPPPPPPQ P Sbjct: 2 ATPSKRRPPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPPPPP+ PP PPP Sbjct: 11 PPPPPPPRLLVLPPLPP--PPPPPPP 34 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPP 633 +K PPPP G PPPP P Sbjct: 108 RKSPPPPPSKYGKVYPPPPAKP 129 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPP 630 A+ +K PPPP G PPP P Sbjct: 104 AYYYRKSPPPPPSKYGKVYPPPPAKP 129 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +1 Query: 571 KXPPP--PXXXGGXXXPPPPPPPQXXXTPP 654 + PPP P PPPPPPP PP Sbjct: 87 RLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +1 Query: 580 PPPXXXGGXXXP--PPPPPPQXXXTPPXA 660 PPP P PPPPPP PP A Sbjct: 89 PPPLLPPPEEPPREPPPPPPPPEEPPPPA 117 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPP----PPPPPQXXXTPPXAXGGXXAXPP 687 PPPP PP PPPPP PP PP Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 ++ PPPP P PPP +PP PPP Sbjct: 490 RRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP + PPP Sbjct: 602 PPPPVHSPPPPVYSPPPPPPVHSPPPPV----FSPPPP 635 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPP PP PP Sbjct: 603 PPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPP 640 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PP Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPP 610 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXF 570 GG P + GG GGGG GG GGG F Sbjct: 854 GGFGGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGGGGF 893 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 57 PPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 99 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 85 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 127 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 113 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 155 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 141 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 183 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 169 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 211 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 197 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 239 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 225 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 267 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 253 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 295 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 281 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 323 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 309 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 351 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 337 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPP 379 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-----PPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PPP PP PPP Sbjct: 365 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPP 407 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP +PP + PPP Sbjct: 393 PPPPKEK--YVYKSPPPPPVHHYSPPHHPYLYKSPPPP 428 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 24.6 bits (51), Expect(2) = 2.7 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +1 Query: 613 PPPPPPPQ 636 PPPPPPP+ Sbjct: 397 PPPPPPPE 404 Score = 23.4 bits (48), Expect(2) = 2.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPP 630 PP PPPPPP Sbjct: 359 PPLVYSPPPPPPPPPP 374 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPP PPPPPP PP + PPP Sbjct: 55 PPPSPSLPLSSSPPPPPPHKHSPPPLSQS---LSPPP 88 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP-PPQXXXTPPXAXGGXXAXPPPXG 696 PPPP PPPPP P +PP + P P G Sbjct: 95 PPPPRFYYFESTPPPPPLSPDGKGSPPSVPS---SPPSPKG 132 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPPP TPP PPP Sbjct: 104 KPPPPPYVKPPPPPTVKPPPPPTPYTPPPPT--PYTPPPP 141 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP PP PPP Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPP 167 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPP P P Sbjct: 153 PPPPTPTPEAPCPPPPPTPYPPPPKP 178 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -1 Query: 457 GXPFXXKXXFFXXXFXGGXPPPXXXFFXXGXPPPPPXGGXPP 332 G P + F G PPP PPPPP PP Sbjct: 36 GTPKEKRRWSFRRSSATGPPPPACAITLKDSPPPPPPPPPPP 77 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTP 651 S PPPP PPPPPP P Sbjct: 49 SSATGPPPPACAITLKDSPPPPPPPPPPPP 78 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 29.5 bits (63), Expect = 3.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQ 636 +++ PPP PPPPPPP+ Sbjct: 20 RRQRAPPPQPPPPPPPPPPPPPPR 43 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 616 PPPPPPQXXXTPPXAXGGXXAXPP 687 PPPPPP PP A PP Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPP 216 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGG 579 GG A GG WGGGGGGG GGG Sbjct: 35 GGAGGGEWGGAEGG--GAWGGGGGGGGAWGGEGEGGG 69 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG GG WGG G GG GGGG Sbjct: 43 GGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGG 80 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXP 684 PPP PP PPPP+ P + G P Sbjct: 126 PPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKP 160 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PPPP P PPPP Q GG Sbjct: 126 PPPPPADEDESPPAPPPPEQLPPPASSPQGG 156 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG-XXAXPPP 690 PPPP PP PP PP A PPP Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPP 106 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PP PPQ PP A PPP G Sbjct: 30 PPPPQ---GAYPPPGGYPPQGYPPPPHGY-PPAAYPPPPG 65 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 601 GXXXPPP--PPPPQXXXTPPXAXGGXXAXPPPXG 696 G PP PPPPQ PP PPP G Sbjct: 21 GHGYPPGAYPPPPQGAYPPPGGYPPQGYPPPPHG 54 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GGGGGG GGGG Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGG 86 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG A A GG GG GGG GGGG Sbjct: 218 GGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGG 255 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG A G GG GGGG GGGG Sbjct: 176 GGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGG 213 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 Q+ PPPP PP PP PP G P GG Sbjct: 34 QQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGYPPAPGYGG 78 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPP P +PP + PPP Sbjct: 56 PPPPVVSSPPPSSSPPPSPPVITSPPPTVAS--SPPPP 91 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 P P PPP P TPP A A PPP Sbjct: 26 PTPTATPPPATPPPVATPPPVATPPPAATPAPATPPP 62 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPP PPQ PP + PPP Sbjct: 1133 PPSPPPQPPSSPPPPSSPPQLAPAPPPS---DHCLPPP 1167 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 313 KKKKKXXGGXPPXGGGGGXPXKKXXXXGGXPP 408 K KK GG GGGGG GG PP Sbjct: 53 KPNKKWGGGMGGGGGGGGGSGGGGGGRGGGPP 84 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPP 633 S + PPPP P PPPPP Sbjct: 320 SLRSQPPPPPPSPEHKAPAPPPPP 343 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPP 633 + + PPPP PPPPPP Sbjct: 322 RSQPPPPPPSPEHKAPAPPPPPP 344 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 PP P PPP PPP +PP + PPP Sbjct: 15 PPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPP 56 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPP 633 PPP PPPPPPP Sbjct: 217 PPPKPPSPPRKPPPPPPP 234 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/42 (33%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXA-XGGXXAXPPPXGG 699 PPP PPPPPPP + + PPP G Sbjct: 217 PPPKPPSPPRKPPPPPPPPAFMSSSGGSDYSDLPVLPPPSPG 258 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXG-GXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP G G PPP PP P G + PPP G Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYG 46 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXG-GXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP G G PPP PP P G + PPP G Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYG 46 >At3g10300.1 68416.m01234 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 232 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +1 Query: 577 PPPPXXXG-GXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PP G G PPP PP P G + PPP G Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYG 46 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPPP +PP + PPP Sbjct: 82 KSPPPPYVYSSP--PPPVKSPPPPYYYHSPPPP---VKSPPPP 119 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPPP +PP + PPP Sbjct: 50 KSPPPPYEYKSP--PPPVKSPPPPYYYHSPPPP---VKSPPPP 87 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPPP +PP + PPP Sbjct: 66 KSPPPPYYY--HSPPPPVKSPPPPYVYSSPPPP---VKSPPPP 103 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPPP +PP + PPP Sbjct: 98 KSPPPPYYYHSP--PPPVKSPPPPYYYHSPPPP---VKSPPPP 135 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPPP +PP + PPP Sbjct: 114 KSPPPPYYYHSP--PPPVKSPPPPYYYHSPPPP---VKSPPPP 151 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPPP +PP + PPP Sbjct: 130 KSPPPPYYYHSP--PPPVKSPPPPYYYHSPPPP---VKSPPPP 167 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPPP +PP + PPP Sbjct: 146 KSPPPPYYYHSP--PPPVKSPPPPYYYHSPPPP---VKSPPPP 183 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP---PPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPP PPPP +PP + PPP Sbjct: 162 KSPPPPYYY--HSPPPPVKSPPPPYLYSSPPPP---VKSPPPP 199 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -3 Query: 695 PXGGGXAXXPPXAXGGVXXXWGGGGGG--GXXXPPXXXGGGG 576 P GGG GG GGGGGG G GGGG Sbjct: 94 PPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGG 135 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG P GG G G GGG G GG Sbjct: 104 GGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGG 141 >At1g12380.1 68414.m01431 expressed protein Length = 793 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXG 666 PPPPPPP PP G Sbjct: 14 PPPPPPPPPAPAPPAMDG 31 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 29.1 bits (62), Expect = 4.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 613 PPPPPPPQXXXTPP 654 PPPPPPPQ T P Sbjct: 171 PPPPPPPQAPITAP 184 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 25.8 bits (54), Expect(2) = 4.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 613 PPPPPPPQ 636 PPPPPPPQ Sbjct: 1237 PPPPPPPQ 1244 Score = 21.4 bits (43), Expect(2) = 4.3 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPP 630 P P PPPPPP Sbjct: 1227 PYPSHPHPHPPPPPPPP 1243 >At5g61270.1 68418.m07689 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 366 Score = 25.0 bits (52), Expect(2) = 4.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 601 GXXXPPPPPPP 633 G PPPPPPP Sbjct: 287 GGLVPPPPPPP 297 Score = 24.6 bits (51), Expect(2) = 8.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 598 GGXXXPPPPPP 630 GG PPPPPP Sbjct: 287 GGLVPPPPPPP 297 Score = 22.2 bits (45), Expect(2) = 4.8 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 619 PPPPPQXXXTPP 654 PPPPP PP Sbjct: 291 PPPPPPPMMVPP 302 Score = 21.8 bits (44), Expect(2) = 8.0 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 616 PPPPPPQXXXTP 651 PPPPPP P Sbjct: 291 PPPPPPPMMVPP 302 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 632 GGGGGGGXXXPPXXXGGGGXF 570 GGGGGGG GGGG F Sbjct: 9 GGGGGGGGSGGGIGGGGGGRF 29 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 9/49 (18%) Frame = +1 Query: 577 PPPPXXXG---GXXXPPP------PPPPQXXXTPPXAXGGXXAXPPPXG 696 PPPP G PPP PPPP PP + G PPP G Sbjct: 186 PPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPG---MPPPGG 231 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPP GG P PPP P G PP G Sbjct: 186 PPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPG 225 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPPPPPPQXXXTPP 654 K+ PPPP PPPPP Q PP Sbjct: 105 KRPPPPPPK---PQPPPPPPRSQKPMQPP 130 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PP P P+ P + PPP Sbjct: 252 KSPPPPYVYSSPPPPPYSPSPKVEFKSPPPPYIYNSPPPP 291 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGGXFFXXKKAPPP 543 GGG A GG GGGGGG GGGG + P P Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGG-----SGGGGGGGGDSQRSIPTP 59 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPP---PPPQXXXTPPXAXGGXXAXPPP 690 K PPPP PPPP P P+ PP + PPP Sbjct: 449 KSPPPPYVYSS---PPPPYYSPSPKVDYKPPPPPYVYSSPPPP 488 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPP---PPPQXXXTPPXAXGGXXAXPPP 690 K PPPP G PPPP P P+ P + PPP Sbjct: 274 KSPPPPYVYGS---PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 313 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPPP---PPPQXXXTPPXAXGGXXAXPPP 690 K PPPP G PPPP P P+ P + PPP Sbjct: 324 KSPPPPYVYGS---PPPPYYSPSPKVDYKSPPPPYVYSSPPPP 363 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 28.7 bits (61), Expect = 5.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGG 669 PP GG PPPPPP+ GG Sbjct: 11 PPRRGYGGRGRSPPPPPPRRGYGGGGGGGG 40 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 28.7 bits (61), Expect = 5.3 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 598 GGXXXPPPPPPPQXXXTPP 654 G PPPPPPP+ PP Sbjct: 39 GQTLTPPPPPPPRPPPPPP 57 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPP--PPPPQXXXTPPXAXGGXXAXPPP 690 P PP PPP P PP PP A PPP Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPP 138 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP T P PPP Sbjct: 110 PPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPP 147 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 28.7 bits (61), Expect = 5.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP + PPP Sbjct: 720 PPPPVHSPPPPVQSPPPPPVFSPPPP---APIYSPPPP 754 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PP Sbjct: 670 PPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 707 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPPP PP PP Sbjct: 752 PPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPP 789 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 695 PXGGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 P GG A P GG GGGG P GG G Sbjct: 151 PALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGAG 190 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG +GGGGGG GGGG Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 129 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 28.7 bits (61), Expect = 5.3 Identities = 25/105 (23%), Positives = 32/105 (30%), Gaps = 9/105 (8%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGG-----XXAXPPPXGGXXXXXXXX 723 K PPPP PPP PPPP +PP + PPP Sbjct: 60 KSPPPPVKH---YSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYK 116 Query: 724 XXXRQQKKFXXXXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRP 858 K + ++ P + +PPPP K P Sbjct: 117 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 28.7 bits (61), Expect = 5.3 Identities = 25/105 (23%), Positives = 32/105 (30%), Gaps = 9/105 (8%) Frame = +1 Query: 571 KXPPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGG-----XXAXPPPXGGXXXXXXXX 723 K PPPP PPP PPPP +PP + PPP Sbjct: 60 KSPPPPVKH---YSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYK 116 Query: 724 XXXRQQKKFXXXXXHRXXPXXGRXGGGXXXXXAPPPPXKKXKXRP 858 K + ++ P + +PPPP K P Sbjct: 117 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTP 651 PPPP G PPPPP P Sbjct: 251 PPPPGSMGTNWVSSPPPPPPGNWQP 275 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 Query: 616 PPPPPPQXXXTPPXAXGGXXAXPPP 690 PP PPP +PP + PPP Sbjct: 11 PPAPPPPSPPSPPSSNDQQTTSPPP 35 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 698 PPXGGGX-AXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 PP G G A PP + G +GG GG P G GG Sbjct: 199 PPTGYGMEAVPPPTSYSGGPPSYGGPRGGYGSDAPSTGGRGG 240 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 698 PPXGGGX-AXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 PP G G A PP + G +GG GG P G GG Sbjct: 199 PPTGYGMEAVPPPTSYSGGPPSYGGPRGGYGSDAPSTGGRGG 240 >At5g24620.1 68418.m02908 thaumatin-like protein, putative similar to thaumatin-like protein [Arabidopsis thaliana] GI:2435406; contains Pfam profile PF00314: Thaumatin family Length = 420 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +1 Query: 565 QKKXPPPPXXXGGXXXPPPPPPP---QXXXTPP--XAXGGXXAXPPP 690 Q PP G PP PPPP + TPP G PPP Sbjct: 322 QPLAPPTQNQYGQPMAPPTPPPPGPNEDSMTPPPQNQNGDGQFMPPP 368 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 S PPPP PPP P P P G + P G Sbjct: 159 SDPPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPG 203 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 601 GXXXPPPPPPPQXXXTPP 654 G PPPPPPP PP Sbjct: 66 GYGFPPPPPPPLSPPPPP 83 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP----XAXGGXXAXPPPXG 696 PPP GG PPPP P G A PPP G Sbjct: 210 PPPSGMPGGPLSNGPPPPMMGPGAFPRGSQFTSGPMMAPPPPYG 253 >At3g29060.1 68416.m03635 EXS family protein / ERD1/XPR1/SYG1 family protein similar to PHO1 protein [Arabidopsis thaliana] GI:20069032; contains Pfam profiles PF03105: SPX domain, PF03124: EXS family Length = 794 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXPPPXGG 699 PPPPPPP T P G GG Sbjct: 44 PPPPPPPSTGDTVPLKTDGGEGGGGGGGG 72 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-PPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PP PP TP PPP Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 137 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPP-PPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PP PP TP PPP Sbjct: 117 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 155 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP P PP P +PP P P Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTP 190 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXP 684 PPPPPPP PP A P Sbjct: 24 PPPPPPPSSSLPPPPLPTEIQANP 47 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXP 684 PPPPPPP PP A P Sbjct: 24 PPPPPPPSSSLPPPPLPTEIQANP 47 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PP PPP + P A PP Sbjct: 126 PPPPYPRQVHPQPPAPPPYKFHQKEPVAKSFPPTPAPP 163 >At2g35270.1 68415.m04326 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 285 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -3 Query: 632 GGGGGGGXXXPPXXXGGGG-XFFXXKKAPP 546 GGGGGGG GGGG FF + P Sbjct: 237 GGGGGGGNMYSEATGGGGGLPFFNLPMSMP 266 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPP 597 GGG GG GGGGGGG P Sbjct: 26 GGGGGGGAKGGCGGGGKSGGGGGGGGYMVAP 56 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG + G GGGGGG GGGG Sbjct: 87 GGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGG 124 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 686 GGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GG A GG GGGGGGG GGGG Sbjct: 92 GGGAGGKSGCGGGKS---GGGGGGGKNGGGCGGGGGG 125 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 28.3 bits (60), Expect = 7.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 613 PPPPPPPQXXXTPP 654 PPPPPPP +PP Sbjct: 39 PPPPPPPPLSLSPP 52 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXAXGGXXAXP 684 PPPPPPP PP G P Sbjct: 248 PPPPPPPPPPPPPPQRLYGENDTP 271 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGG----XXAXPPP 690 PPPP PPPP Q PP + G + PPP Sbjct: 268 PPPPNMNQSYQGPPPPNMNQSYQGPPPSNMGQNYRGPSLPPP 309 >At1g23050.1 68414.m02880 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 161 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 580 PPPXXXGGXXXP----PPPPPPQXXXTPPXAXGGXXAXPPPXG 696 P P GG P PPP PP P A G PPP G Sbjct: 38 PTPPIGGGSSTPSMTQPPPYPPPGVNYPTPA-GNLPNYPPPVG 79 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 28.3 bits (60), Expect = 7.0 Identities = 25/88 (28%), Positives = 27/88 (30%) Frame = +3 Query: 309 GEKKKKXXGGXPPXGGGGGXPXXKXXXXGGGXPPXKXXXKKXXXXXKGXPXGXXGXXXGG 488 GE KKK GG GGG GGG K G G G G Sbjct: 32 GEGKKKNGGGE-----GGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDG 86 Query: 489 GKXXXXXGRXFFFXXXXGGGGGFFXXKK 572 K G GGG G + +K Sbjct: 87 TKGGGRRGDGLGRGLGRGGGRGGWNGRK 114 >At1g21500.1 68414.m02689 expressed protein Length = 126 Score = 24.2 bits (50), Expect(2) = 7.0 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +1 Query: 541 GGGGAFXSQKKXPPPPXXXGGXXXPPPPPPPQ 636 G GGA S PPPPPP + Sbjct: 47 GLGGALWSWNALAAKEEAMAAARRPPPPPPKE 78 Score = 22.6 bits (46), Expect(2) = 7.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 Query: 616 PPPPPPQXXXTP 651 PPPPPP+ P Sbjct: 71 PPPPPPKEKKDP 82 >At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chloroplast, putative / Mg-protoporphyrin IX chelatase, putative (CHLD) similar to Mg-chelatase SP|O24133 from Nicotiana tabacum, GB:AF014399 GI:2318116 from [Pisum sativum] Length = 760 Score = 25.8 bits (54), Expect(2) = 7.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 613 PPPPPPPQ 636 PPPPPPPQ Sbjct: 412 PPPPPPPQ 419 Score = 20.6 bits (41), Expect(2) = 7.5 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +1 Query: 583 PPXXXGGXXXPPPPP 627 PP PPPPP Sbjct: 404 PPEQQNQPPPPPPPP 418 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 24.6 bits (51), Expect(2) = 7.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 616 PPPPPPQXXXTPP 654 PPPPPP PP Sbjct: 105 PPPPPPPPPPPPP 117 Score = 21.8 bits (44), Expect(2) = 7.6 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 583 PPXXXGGXXXPPPPPPP 633 PP PP PPPP Sbjct: 68 PPSPSPPPPPPPRPPPP 84 >At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK18) identical to CBL-interacting protein kinase 18 [Arabidopsis thaliana] gi|14334388|gb|AAK59695 Length = 520 Score = 24.2 bits (50), Expect(2) = 7.7 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 562 SQKKXPPPPXXXGGXXXPPPPPPP 633 +Q PP PPPPPPP Sbjct: 2 AQALAQPPLVVTTVVPDPPPPPPP 25 Score = 22.2 bits (45), Expect(2) = 7.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 613 PPPPPPPQXXXTPPXA 660 P PPPPP P A Sbjct: 17 PDPPPPPPPPHPKPYA 32 >At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family protein bHLH transcription factor GBOF-1, Tulipa gesneriana, EMBL:AF185269; contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain Length = 297 Score = 25.8 bits (54), Expect(2) = 8.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 613 PPPPPPPQ 636 PPPPPPPQ Sbjct: 39 PPPPPPPQ 46 Score = 20.6 bits (41), Expect(2) = 8.2 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +1 Query: 583 PPXXXGGXXXPPPPP 627 PP PPPPP Sbjct: 31 PPCWDPSLPPPPPPP 45 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 580 PPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPPXG 696 PPP G PPPPPP P G PP G Sbjct: 348 PPP---GMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYG 383 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPP 654 PPPP PPPPPPP TPP Sbjct: 266 PPPP----SSPPPPPPPPP----TPP 283 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +1 Query: 568 KKXPPPPXXXGGXXXPPP----PPPPQXXXTPPXAXGGXXAXPPP 690 KK PPPP PPP P PP P PPP Sbjct: 73 KKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPP 117 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG P G GGGGGGG GGGG Sbjct: 106 GGGGGGGPANNNKGQKIGGGGGGGGGG----GGGGGGG 139 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -3 Query: 689 GGGXAXXPPXAX-GGVXXXWGGGGGGGXXXPP 597 GGG A GG GGGGGGG PP Sbjct: 110 GGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 >At4g36260.1 68417.m05157 zinc finger protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702), TIGR01624: LRP1 C-terminal domain, TIGR01623: putative zinc finger domain, LRP1 type Length = 322 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 632 GGGGGGGXXXPPXXXGGGG 576 GGGGGG PP GGG Sbjct: 265 GGGGGGHPFNPPVVTDGGG 283 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 553 AFXSQKKXPPPPXXXGGXXXPPPPPPPQXXXTP 651 +F S +K P P PPPPPP P Sbjct: 261 SFSSPRKSNPIPNLASEFHPSPPPPPPPPPPLP 293 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 665 PXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 P A GG GGGGGG GGGG Sbjct: 118 PRAYGGGGGYSYGGGGGGYGGGGGGYGGGG 147 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 665 PXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 P A GG GGGGG G GGGG Sbjct: 118 PRAYGGGGGYSGGGGGYGGGGGGYGGGGGG 147 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 632 GGGGGGGXXXPPXXXGGGGXFF 567 GG GGGG GGGG FF Sbjct: 28 GGHGGGGHGRGGHGRGGGGIFF 49 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPPPPQXXXTPPXAXGGXXAXPPP 690 PPPP PPPP Q P G PPP Sbjct: 28 PPPPPPQS---QPPPPQTQQQTYPPVMGYPGYHQPPPP 62 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 27.9 bits (59), Expect = 9.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 613 PPPPPPPQXXXTPP 654 PPPPPPP PP Sbjct: 107 PPPPPPPSPSPPPP 120 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 Query: 632 GGGGGGGXXXPPXXXGGGGXF 570 G GGGGG P GGGG + Sbjct: 609 GEGGGGGGGGGPGGGGGGGPY 629 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 577 PPPPXXXGGXXXPPPPP--PPQXXXTPPXAXGGXXAXPPP 690 PPP PPP P PP +PP A A PPP Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPA----PASPPP 148 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGGG 576 GGG GG GG GGGG P GGGG Sbjct: 131 GGGFGGGAGYGSGGGLGWDGGNGGGG---PGYGSGGGG 165 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 689 GGGXAXXPPXAXGGVXXXWGGGGGGGXXXPPXXXGGG 579 GGG GGV GGGG GG GGG Sbjct: 162 GGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,888,962 Number of Sequences: 28952 Number of extensions: 383658 Number of successful extensions: 8900 Number of sequences better than 10.0: 171 Number of HSP's better than 10.0 without gapping: 1077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5505 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2009406400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -