BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A18 (925 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 31 1.3 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -1 Query: 565 YXXTPXTXPFXXSXPFXXLXLTXSFLXYXXXXXXXXXXPXXXLIPLXXXXXPXXXXH 395 Y TP T PF S PF L LT SFL Y P LIPL P H Sbjct: 559 YGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAATH 615 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 106 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 136 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 72 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 102 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FFP LSP S N IT F Sbjct: 30 FLRFLAFCWPFAHMFFPALSPDSVDNRITAF 60 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 565 YXXTPXTXPFXXSXPFXXLXLTXSFLXYXXXXXXXXXXPXXXLIPLXXXXXP 410 Y TP T PF S PF L LT SFL Y P LIPL P Sbjct: 763 YGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 814 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 565 YXXTPXTXPFXXSXPFXXLXLTXSFLXYXXXXXXXXXXPXXXLIPLXXXXXP 410 Y TP T PF S PF L LT SFL Y P LIPL P Sbjct: 5 YGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 565 YXXTPXTXPFXXSXPFXXLXLTXSFLXYXXXXXXXXXXPXXXLIPLXXXXXP 410 Y TP T PF S PF L LT SFL Y P LIPL P Sbjct: 28 YGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 79 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 565 YXXTPXTXPFXXSXPFXXLXLTXSFLXYXXXXXXXXXXPXXXLIPLXXXXXP 410 Y TP T PF S PF L LT SFL Y P LIPL P Sbjct: 410 YGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 461 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 565 YXXTPXTXPFXXSXPFXXLXLTXSFLXYXXXXXXXXXXPXXXLIPLXXXXXP 410 Y TP T PF S PF L LT SFL Y P LIPL P Sbjct: 27 YGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 78 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -1 Query: 565 YXXTPXTXPFXXSXPFXXLXLTXSFLXYXXXXXXXXXXPXXXLIPLXXXXXP 410 Y TP T PF S PF L LT SFL Y P LIPL P Sbjct: 5 YGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H F+P LSP S N IT F Sbjct: 14 FLRFLAFCWPFAHMFYPALSPDSVDNRITAF 44 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 32.3 bits (70), Expect = 0.57 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H FF LSP N IT F Sbjct: 30 FLRFLAFGWPFAHMFFRALSPDCVDNRITAF 60 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 539 FXXFXXFXXPFXHXFFPXLSPXSXXNXITXF 447 F F F PF H F P LSP S IT F Sbjct: 14 FLRFLAFCWPFDHMFSPALSPDSVDICITAF 44 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,619,230 Number of Sequences: 59808 Number of extensions: 40806 Number of successful extensions: 731 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2681370225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -