BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A15 (946 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 6.0 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 6.0 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 8.0 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 127 PRRVLRWLLTPHLHQDTDXVLAE--QLYMSVVIGEYENRY 240 PR L +T LH+ T V+AE + + +V+ E + Y Sbjct: 236 PRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVY 275 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.2 bits (45), Expect = 6.0 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 127 PRRVLRWLLTPHLHQDTDXVLAE--QLYMSVVIGEYENRY 240 PR L +T LH+ T V+AE + + +V+ E + Y Sbjct: 236 PRYYLEKKVTRRLHRFTKSVIAERQENFKEIVVPETDEVY 275 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 8.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 290 EAVKRLIENGKXKTMDFAXQLW 355 E + L +NGK +T D LW Sbjct: 391 EIITYLEKNGKPRTTDTFLDLW 412 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,480 Number of Sequences: 336 Number of extensions: 1337 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26582281 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -