BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A15 (946 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18... 26 1.9 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 7.7 >AF117750-1|AAD38336.1| 380|Anopheles gambiae serine protease 18D protein. Length = 380 Score = 25.8 bits (54), Expect = 1.9 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +2 Query: 191 RSSCI*VSSLVNTRTAIAK---CSEYLKEKKGEVIKEAV 298 R +C+ S ++N RTAIA +EYL K E+ K A+ Sbjct: 248 RPACLYPSEVLNVRTAIATGFGRTEYLGAKSDELRKVAL 286 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 7.7 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 157 PHLHQDTDXVLAEQLYMSV-VIGEYENRYRQM 249 P + QDT +L ++ V+G+ E YRQ+ Sbjct: 769 PTIQQDTTDILLRWRRRAIAVVGDVEKMYRQV 800 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 422,612 Number of Sequences: 2352 Number of extensions: 5596 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 103362750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -