Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP04_F_A14
         (925 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_902| Best HMM Match : Collagen (HMM E-Value=0.00027)                29   5.3  

>SB_902| Best HMM Match : Collagen (HMM E-Value=0.00027)
          Length = 617

 Score = 29.1 bits (62), Expect = 5.3
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 6/65 (9%)
 Frame = +2

Query: 170 LHPSAAILVAAGAWLL------PATKWVCRTVSCTYLFSFK*L*ILFQFVYYCIMVKLEF 331
           L  S +ILVA G+ +L       +  W+C T SC  LF +  L + + F+   I+V L  
Sbjct: 213 LFMSPSILVAVGSAVLIHVAFYSSRTWICSTYSCRLLF-YSQLDLQYLFISPSILVALGS 271

Query: 332 QLYSY 346
           ++  Y
Sbjct: 272 EVIIY 276


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,922,459
Number of Sequences: 59808
Number of extensions: 216604
Number of successful extensions: 654
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 631
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 653
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2681370225
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)