BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A14 (925 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83112-1|CAB05538.1| 742|Caenorhabditis elegans Hypothetical pr... 29 6.2 Z66567-3|CAA91489.1| 444|Caenorhabditis elegans Hypothetical pr... 29 6.2 >Z83112-1|CAB05538.1| 742|Caenorhabditis elegans Hypothetical protein K02B7.1 protein. Length = 742 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 186 PSWSPLGRGCCQLQNGFVERYHVPIYLVLSNC 281 P +SP G G C QN ++ H+ +L C Sbjct: 429 PHYSPKGNGICSRQNRWIFHQHLRFHLDFVRC 460 >Z66567-3|CAA91489.1| 444|Caenorhabditis elegans Hypothetical protein ZK455.3 protein. Length = 444 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +2 Query: 104 LRNXTXAILCQVGXSPIAFRVGLHPSAAILVAAGAWLLPATKWVCRTVS 250 +RN T ++ + S + F + P A+ AA W+ P +W C ++ Sbjct: 73 MRNSTNTLIIGLAISDLMFLLLCVPFTAVDYAAPTWIFP--EWTCSMIN 119 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,832,401 Number of Sequences: 27780 Number of extensions: 161545 Number of successful extensions: 309 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2370744068 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -