BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A13 (742 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 42 7e-04 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 41 0.001 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 39 0.005 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 39 0.005 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 38 0.006 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 35 0.060 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 35 0.060 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.060 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 35 0.060 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.060 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 35 0.060 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 34 0.14 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 33 0.32 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 33 0.32 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 27 0.41 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 32 0.42 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 27 0.45 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 27 0.47 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 32 0.56 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 31 0.74 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 31 0.74 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 0.98 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 31 1.3 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 31 1.3 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 30 1.7 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 30 2.3 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 30 2.3 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 29 3.0 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 3.6 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 29 4.0 SB_51034| Best HMM Match : Extensin_2 (HMM E-Value=0.038) 29 5.2 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 24 6.1 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 24 6.4 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 28 6.9 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 23 9.6 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP QPP PPPPPPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP P PPPPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPPPPPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP P PP PPPPPPPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPP PP PP PPPPPPPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP P PPPPPPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP P PPPPPPPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP P PP PPPPPPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 P PPPP PP PPPPPPPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 35.5 bits (78), Expect = 0.046 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPPP PPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP P PP PPPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PP PPP PP PPPPPP P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 P PPPP PP PPPPP PP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPP PPPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP P PP PP PPPPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPP PP PP P PPPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PP PPP PP PPPPPPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 31.5 bits (68), Expect = 0.74 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 615 PPPPPPXXXXXNPXXXXXXXXXXXXXXXPPPPPPP 719 PP PPP P PPPPPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 31.5 bits (68), Expect = 0.74 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 8/43 (18%) Frame = +2 Query: 614 PPPPPPXXXXX--------QPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 31.5 bits (68), Expect = 0.74 Identities = 16/54 (29%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 564 PPSPFXXXXXXAVFXXXPPPPPPXXXXXN--PXXXXXXXXXXXXXXXPPPPPPP 719 PP P ++ PPPPPP P PPPPP P Sbjct: 679 PPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 614 PPPPPPXXXXX--QPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPP P P Sbjct: 698 PPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPPP PP PPPPPPP Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPP Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 35.9 bits (79), Expect = 0.034 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 620 PPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP PP PPPPPPPP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 564 PPSPFXXXXXXAVFXXXPPPPPPXXXXXNPXXXXXXXXXXXXXXXPPPPPPP 719 PP P V PPPPPP P PPPPPP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPP 712 PPPPP PP PPPPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPP 319 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPP PP PPPPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPP 319 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPP P PPPPPPP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPPP PP PPPPPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 35.5 bits (78), Expect = 0.046 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPP PP PPPPPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 35.5 bits (78), Expect = 0.046 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP P PPPPPPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 35.5 bits (78), Expect = 0.046 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPPPPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 34.7 bits (76), Expect = 0.080 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 P PPPP P PPPPPPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 322 SPKGPPLXFXXPPPPXFPPGXXPRGGG 402 +P PP PPPP PP P GG Sbjct: 303 APPPPPPPGGAPPPPPPPPPPPPGDGG 329 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPP PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 31.1 bits (67), Expect = 0.98 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP P PP PPP PP P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPP P PP P PPP P Sbjct: 219 PPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 36.3 bits (80), Expect = 0.026 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 614 PPPPPPXXXXXQPP--XXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP 989 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +2 Query: 614 PPPPP----PXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP P PP PPPPPPPP Sbjct: 955 PPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXP----PPPPPPP 718 PPPPPP PP P PPPPPPP Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPP----PPPPPP 718 PPPPPP P PP PPPPPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 620 PPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP PP PP PPPP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPP PP PP PPPP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 818 GGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGG 852 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 714 GGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGG GG GGGGGG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGGXXKKXXXXXXXKKG 571 GGGGGGGG GG GGGGGG K +KG Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGG-----GGGGGGVIKNEESSTDQQKG 890 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 G GGGGGG GG GGGGGG Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GGGGGG Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GGGGGG Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GGGGGG Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GGGGGG Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGG G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGG GG Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GG GGG Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGG GG GGGGGG Sbjct: 819 GGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGG 853 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 711 GGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGG GG GGGGGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGG 801 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGG 616 GGGGGG G GG GGGGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 714 GGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGG GG GGGGGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 716 GGGGGGXGXXXXXXXXXXXXXGVXXXXXGGGGGG 615 GGGGGG G G GGGGGG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGG GG GG GGGG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDG 804 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPPP P PPPPPPP Sbjct: 51 PPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 34.7 bits (76), Expect = 0.080 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 615 PPPPPPXXXXXNPXXXXXXXXXXXXXXXPPPPPPP 719 PPPPPP N PPPPPPP Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPPP + PPPPPPP Sbjct: 25 PPPPPPTRPFER--NIHPRTEPRDRERPPPPPPP 56 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 75 GGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGG 616 GGGGGGGG GG GGGGG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GGGGGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GGGGGG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GGGGGG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGG G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGG GG Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGG Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGG GG GGGGGG Sbjct: 77 GGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 714 GGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGG GG GG GGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGG 95 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GG GGG Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGG GG GGGGGG Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.1 bits (77), Expect = 0.060 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPPPPPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 Score = 34.7 bits (76), Expect = 0.080 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPPPPPP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 34.7 bits (76), Expect = 0.080 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPPPPPP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 31.9 bits (69), Expect = 0.56 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP PP PPPPPPP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 31.9 bits (69), Expect = 0.56 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPPP PP PPPPPPP Sbjct: 365 PPPPPPTNKPPPPPPPTNG--------PPPPPPP 390 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGGGG Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGGG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GGG GG Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GG GGGGG GG GGGGGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 G GGGGGG GG GGGGGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG G GG G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG GG GG G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 G GG GGG GG GGGGGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGG 616 GGGGGGGG GG G G G Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 34.7 bits (76), Expect = 0.080 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP P P PPPPPP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPP 811 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 614 PPPPPPXXXXXQ--PPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXX----PPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 107 PPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPP 145 Score = 31.9 bits (69), Expect = 0.56 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PP PPP Sbjct: 139 PPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPP 173 Score = 31.5 bits (68), Expect = 0.74 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 615 PPPPPPXXXXXNPXXXXXXXXXXXXXXXPPPPPPP 719 PPPPPP P P PPPPP Sbjct: 108 PPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPP 142 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPP P Sbjct: 464 PPPPPP--PPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 1161 PPPPPPPPSSPSPPPP-----------PPPPPPPP 1184 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPP P Sbjct: 1157 PPPPPPP-----PPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +2 Query: 614 PPPPP---PXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPP P PP PPPPPPP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +2 Query: 617 PPPPPXXXXXQ---PPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPPPPPP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPP 712 P PPPP PP PPPPP Sbjct: 329 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 361 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +2 Query: 614 PPPPP---PXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPP P PP PPPPPPP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +2 Query: 617 PPPPPXXXXXQ---PPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPPPPPP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPP 712 P PPPP PP PPPPP Sbjct: 241 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPP 273 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 26.6 bits (56), Expect(2) = 0.41 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 695 PPPPPPPP 718 PPPPPPPP Sbjct: 1318 PPPPPPPP 1325 Score = 24.2 bits (50), Expect(2) = 0.41 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 614 PPPPPPXXXXXQPP 655 PPPPPP PP Sbjct: 1311 PPPPPPPPPPPPPP 1324 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 32.3 bits (70), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GGGGGG Sbjct: 46 GGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGG 80 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGGGGG G GGGGG Sbjct: 45 GGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGG 79 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 32.3 bits (70), Expect = 0.42 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PP P PP PPPPPPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 31.5 bits (68), Expect = 0.74 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 P PPPP PP PPPPPPPP Sbjct: 223 PTPPPPAAPAPPPPPAAAP--------PPPPPPPP 249 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 32.3 bits (70), Expect = 0.42 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 564 PPSPFXXXXXXAVFXXXPPPPPPXXXXXNPXXXXXXXXXXXXXXXPPPPPPP 719 PP P A PPPPPP P PPPPPPP Sbjct: 284 PPPPSNTPGMFASSGFQPPPPPPTDFAPPP------PPPEPTSELPPPPPPP 329 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPP 712 PPPPPP PP PPPPPP Sbjct: 280 PPPPPP------PPSNTPGMFASSGFQPPPPPP 306 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 26.6 bits (56), Expect(2) = 0.45 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 695 PPPPPPPP 718 PPPPPPPP Sbjct: 287 PPPPPPPP 294 Score = 24.2 bits (50), Expect(2) = 0.45 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 614 PPPPPPXXXXXQPP 655 PPPPPP PP Sbjct: 280 PPPPPPPPPPPPPP 293 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 26.6 bits (56), Expect(2) = 0.47 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 695 PPPPPPPP 718 PPPPPPPP Sbjct: 86 PPPPPPPP 93 Score = 24.2 bits (50), Expect(2) = 0.47 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 614 PPPPPPXXXXXQPP 655 PPPPPP PP Sbjct: 79 PPPPPPPPPPPPPP 92 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 31.9 bits (69), Expect = 0.56 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 7/42 (16%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXP-------PPPPPPP 718 PPPPPP PP P PPPPPPP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 31.9 bits (69), Expect = 0.56 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXP---PPPPPPP 718 PPPPPP P P PPPPPPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPP 201 Score = 31.1 bits (67), Expect = 0.98 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +2 Query: 614 PPPPP--PXXXXXQP--PXXXXXXXXXXXXXPPPPPPPP 718 PPPPP P P P PPPPPPPP Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPP 203 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP P PPPPP P Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 7/42 (16%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPP-------PPPP 718 PPPPP PP PPPP PPPP Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPP 712 PPPP Q P PPPPPP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 620 PPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP PP PPPPPPPP Sbjct: 188 PPPPSGGPPPPPPP-----------PPPPPPPP 209 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.5 bits (68), Expect = 0.74 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = +1 Query: 166 VENADSGNGYEPIDTRPGTSLIPPKRLXTLNWXXGLXNPXXKX--GGPXXRXTRSPKGPP 339 +E D G RP T+ IPP T+ P P P GPP Sbjct: 1188 MEGGDFMKGRMSNPNRPPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPP 1247 Query: 340 LXFXXPPPPXFPPGXXP 390 PPP PPG P Sbjct: 1248 KFMGLPPP---PPGMRP 1261 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPP PP P PP PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPP 1267 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 602 FXXXPPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 F PPPPP P PP PP PP Sbjct: 1249 FMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 31.5 bits (68), Expect = 0.74 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGG GGGG GG GGGGGG Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGG 118 Score = 31.5 bits (68), Expect = 0.74 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GG GGGGG GG GGGGGG Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 31.5 bits (68), Expect = 0.74 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 G GGGGGG GG GGGGGG Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GG GGG G GG GGGGGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGG 115 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 G GGG GG GG GGGGGG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG 116 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGG GGG GG G GGGG Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGG GGGG GG GGGGG Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 713 GGGGGXGXXXXXXXXXXXXXGVXXXXXGGGGGGXXXKNXP 594 GGGGG G G GGGGGG + P Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARP 133 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 31.5 bits (68), Expect = 0.74 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGG GGGG GG GGGGGG Sbjct: 168 GGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGG 202 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGG GGGG GG GG GGG Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGG 217 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGG GGG GG GGGGG Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGG 201 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGG GGGG GG G GGGG Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGG 212 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGG GGGG GG GG GGG Sbjct: 188 GGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 31.5 bits (68), Expect = 0.74 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PP PPPP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 31.1 bits (67), Expect = 0.98 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPP PP PP PP PPPP Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 31.1 bits (67), Expect = 0.98 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PP PPP PP PPPP PP Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Score = 31.1 bits (67), Expect = 0.98 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPPXXXXF 733 P PPPP PP P PP PPP F Sbjct: 202 PNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQF 241 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPP PP PP PP PPPP Sbjct: 181 PPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PP PPP PP PP PPPP Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPP PP PP PP PP PP Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PP PPP PP P PP PPP Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 P PPPP PP PP PPPP Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPP PP PP PPPP PP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 P PPPP PP PPP PP P Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 P PPPP PP PPP PP P Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +2 Query: 602 FXXXPPPPPPXXXXXQPPXXXXXXXXXXXXXPP--PPPPPP 718 F PP PPP PP PP P PPPP Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPP--PPPP 718 PP PPP PP PPPP P PP Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPP--PPPP 718 PP PPP PP PPPP P PP Sbjct: 106 PPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +1 Query: 289 KXGG-PXXRXTRSPKGPPLXFXX-PPPPXFPPGXXP 390 K GG P + +P PP + PPPP +PP P Sbjct: 79 KCGGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNP 114 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.1 bits (67), Expect = 0.98 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPP--PP 718 PPPPPP PP PPPPPP PP Sbjct: 683 PPPPPP----PPPPPPPPPPPPPQPSTPPPPPPSTPP 715 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 31.1 bits (67), Expect = 0.98 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 5/45 (11%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPP-----PPPXXXXF 733 PPPPPP P PPPPP PPP F Sbjct: 663 PPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGF 707 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPPXXXXF 733 PPPPPP PP PPPPPP F Sbjct: 677 PPPPPPLPGGAAPPPPPPIGGGA------PPPPPPGFGGF 710 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 592 GGXFFXXXPPPPPPXXXXXTPXXXXXXXXXXXXXPXPPPPPP 717 GG PPPPPP P PPPPPP Sbjct: 669 GGQAGGAPPPPPPPLPGGAAPPPPPPIGGG-----APPPPPP 705 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPP + PPPPPPP Sbjct: 886 PPPPPRPAADESQEMSRTRGPKDGRKPPPPPPP 918 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PP PP PP PPPPP PP Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPP 319 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPPXXXXFF 736 PPPPPP PP PPPPPP F+ Sbjct: 311 PPPPPPL-----PPAMPAMDDLLPPEVLSPPPPPPPSEDFY 346 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 602 FXXXPPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 F PPPPP P PPPPPPP Sbjct: 306 FTSPSPPPPPPLPPAMP--AMDDLLPPEVLSPPPPPPP 341 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGG GG GG GGGG G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAG 74 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPP PP PPPPP PP Sbjct: 554 PPPPPPGVDIPPP----LPPSEDPKPPPPPPEPP 583 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 3/38 (7%) Frame = +3 Query: 615 PPPPPPXXXXXNPXXXXXXXXXXXXXXXPP---PPPPP 719 PPPPPP P PP PPPPP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PP PPP PP PPPPP PP Sbjct: 178 PPAPPPPGAPAAPP---APPFGGPPSAPPPPPAPP 209 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +1 Query: 268 GLXNPXXKXGGPXXRXTRSPKGPPLXFXXPPPPXF--PPG 381 G P G P + PKGPP P PP F PPG Sbjct: 43 GPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPG 82 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 268 GLXNPXXKXGGPXXRXTRSPKGPPLXFXXPPPPXFPPG 381 GL P G P P GPP PP P PPG Sbjct: 92 GLPGPNGVNGPPGELGDMGPPGPP----GPPGPQMPPG 125 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPP--PPPPP 718 PPP PP PP PP PPPPP Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPPXXXXF 733 PPP P PP P PPP PP F Sbjct: 76 PPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLPF 115 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPP PP P PPPPP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 620 PPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP PP P P PPPP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 589 GGGXFFXXXPPPPPPXXXXXTP---XXXXXXXXXXXXXPXPPPPPP 717 GG + PPPPPP + P PPPPPP Sbjct: 498 GGSSYKSSNPPPPPPPRNQPSNQNWNQNYDQSNQNMYGPAPPPPPP 543 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGG GGGG GG GG GGG Sbjct: 446 GGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGG GG GG GG GGG Sbjct: 450 GGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 619 PPPPPXXXXXTPXXXXXXXXXXXXXPXPPPPPP 717 P PPP P P PPPPPP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGGXXKK 601 GGGG GGG GG GGGGG +K Sbjct: 1813 GGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGGYSAQK 1851 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GG GGGGG GG GGG GG Sbjct: 1808 GGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GGGGG GG G GGGGGG Sbjct: 1812 GGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/58 (32%), Positives = 21/58 (36%) Frame = +1 Query: 229 IPPKRLXTLNWXXGLXNPXXKXGGPXXRXTRSPKGPPLXFXXPPPPXFPPGXXPRGGG 402 +PPK +W G G P P GPP PPP PP P G G Sbjct: 386 MPPKE----DWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPP-RGPMGPG 438 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 23.8 bits (49), Expect(2) = 3.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 617 PPPPPXXXXXQPP 655 PPPPP QPP Sbjct: 425 PPPPPGFPQFQPP 437 Score = 23.8 bits (49), Expect(2) = 3.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 695 PPPPPPP 715 PPPPPPP Sbjct: 436 PPPPPPP 442 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 259 WXXGLXNPXXKXGGPXXRXTRSPKGPPLXFXXPPPPXFPP 378 W G + P R R P PP PPPP PP Sbjct: 846 WNRGRGRGRSRYRRPRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPPPP PP PPPPPPPP Sbjct: 867 PPPPPPPPP---PP-------------PPPPPPPP 885 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 647 QPPXXXXXXXXXXXXXPPPPPPPP 718 QPP PPPPPPPP Sbjct: 344 QPPTPTTPKTHPQLGPPPPPPPPP 367 >SB_51034| Best HMM Match : Extensin_2 (HMM E-Value=0.038) Length = 354 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPP 712 PPPPPP P P PPPP Sbjct: 73 PPPPPPGPYYQGRPAHWHQPPGGMSYPPAPPPP 105 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 PPPPP Q PP PPPP Sbjct: 73 PPPPPPGPYYQGRPAHWHQPPGGMSYPPAPPPP 105 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 28.7 bits (61), Expect = 5.2 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 695 PPPPPPPPXXXXFF 736 PPPPPPPP F+ Sbjct: 179 PPPPPPPPLFLLFY 192 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 614 PP--PPPPXXXXXQPPXXXXXXXXXXXXXPPP--PPPP 715 PP PPPP PP PPP PPPP Sbjct: 455 PPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPP 492 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 24.2 bits (50), Expect(2) = 6.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 614 PPPPPPXXXXXQPP 655 PPPPPP PP Sbjct: 292 PPPPPPPPPPLPPP 305 Score = 24.2 bits (50), Expect(2) = 6.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 614 PPPPPPXXXXXQPP 655 PPPPPP PP Sbjct: 293 PPPPPPPPPLPPPP 306 Score = 22.6 bits (46), Expect(2) = 6.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 695 PPPPPPPP 718 PPP PPPP Sbjct: 299 PPPLPPPP 306 Score = 22.6 bits (46), Expect(2) = 6.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 695 PPPPPPPP 718 PP PPPPP Sbjct: 300 PPLPPPPP 307 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 24.2 bits (50), Expect(2) = 6.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 614 PPPPPPXXXXXQPP 655 PPPPPP PP Sbjct: 68 PPPPPPPPPPLPPP 81 Score = 24.2 bits (50), Expect(2) = 6.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 614 PPPPPPXXXXXQPP 655 PPPPPP PP Sbjct: 69 PPPPPPPPPLPPPP 82 Score = 22.6 bits (46), Expect(2) = 6.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 695 PPPPPPPP 718 PPP PPPP Sbjct: 75 PPPLPPPP 82 Score = 22.6 bits (46), Expect(2) = 6.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 695 PPPPPPPP 718 PP PPPPP Sbjct: 76 PPLPPPPP 83 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 602 FXXXPPPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPP 715 F PPPPP PP PP PPPP Sbjct: 649 FGGIPPPPPGGGMFPPPP---PPPPGGGVPGPPKPPPP 683 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 4/39 (10%) Frame = +2 Query: 614 PPPPPPXXXXXQPPXXXXXXXXXXXXXP----PPPPPPP 718 P PPPP PP PPPPPPP Sbjct: 1423 PAPPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPP 1461 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 717 GGGGGGGGXXXXXXXXXXXXXGGXXXXXXGGGGGG 613 GG GGGGG GG GGGGG Sbjct: 106 GGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 617 PPPPPXXXXXQPPXXXXXXXXXXXXXPPPPPPPP 718 PPPP PP PPP PP P Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIPTSPPPVPPLP 170 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = -1 Query: 400 PXPGGXXXGGXXGXGAXKXKGXXPWGTGSXXNXAPXFSXKGXXTP 266 P PG GG GA + G P G G P + +G P Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPP 537 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = -1 Query: 400 PXPGGXXXGGXXGXGAXKXKGXXPWGTGSXXNXAPXFSXKGXXTP 266 P PG GG GA + G P G G P + +G P Sbjct: 526 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPP 570 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 23.0 bits (47), Expect(2) = 9.6 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 316 TRSPKGPPLXFXXPPPPXFPPG 381 T S GPP+ PP + PG Sbjct: 250 TTSMSGPPIPVHHGMPPQYGPG 271 Score = 23.0 bits (47), Expect(2) = 9.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 358 PPPXFPPGXXPRG 396 PPP PPG P G Sbjct: 276 PPPGAPPGMLPPG 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,096,010 Number of Sequences: 59808 Number of extensions: 421898 Number of successful extensions: 8493 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3160 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -