BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A12 (876 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 27 0.75 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 2.3 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 2.3 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 4.0 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 24 7.0 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 24 7.0 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 24 7.0 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.2 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 9.2 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 9.2 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 27.1 bits (57), Expect = 0.75 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 435 CTRRCAAPTCSQPEP 391 C C PTCS+PEP Sbjct: 46 CCGPCVEPTCSKPEP 60 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 2.3 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 70 ARAAPRHGPPPLGSCTRARSQLASH 144 A A P H PPLGS + SQ+ H Sbjct: 364 ASATP-HNMPPLGSLCKTVSQIGQH 387 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 2.3 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 70 ARAAPRHGPPPLGSCTRARSQLASH 144 A A P H PPLGS + SQ+ H Sbjct: 364 ASATP-HNMPPLGSLCKTVSQIGQH 387 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.6 bits (51), Expect = 4.0 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 251 HTVTPFCRTDAGCEELVRNIQTNHMEALQYWDIGPSFLVGGNG 379 HT CRT+A E +V+ + + +E L P+FL GNG Sbjct: 126 HTAWGSCRTNAKGEAVVQLVDSLGLEVLN-TGTAPTFL--GNG 165 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.8 bits (49), Expect = 7.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 480 DEPSGAMLEALRSLLRCGVER 542 D+P GA LR L CG++R Sbjct: 442 DQPVGAYWIQLRGLGECGIKR 462 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 23.8 bits (49), Expect = 7.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 480 DEPSGAMLEALRSLLRCGVER 542 D+P GA LR L CG++R Sbjct: 442 DQPVGAYWIQLRGLGECGIKR 462 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.8 bits (49), Expect = 7.0 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 178 KAMGRFDPGARVVPGAAREPRHRPAHSHTL 267 KA PG +V G A P H + H L Sbjct: 36 KAGAATGPGGAIVVGRAETPDHLASQHHAL 65 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 9.2 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -3 Query: 268 EGCDCVLDDDEAHGPRQVRHVHRDQTVPLLFTDDVAIGCY 149 EG C+ D P RH + PL D+ + CY Sbjct: 276 EGVRCLFTSDIYVIPITTRHFIYEIKHPLRLRGDILVRCY 315 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.4 bits (48), Expect = 9.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 403 PAGALVHLAVTSHQERGSDVP 341 PAG +V AVT ++ G D P Sbjct: 295 PAGGVVGYAVTGMRDAGDDDP 315 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.4 bits (48), Expect = 9.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 403 PAGALVHLAVTSHQERGSDVP 341 PAG +V AVT ++ G D P Sbjct: 295 PAGGVVGYAVTGMRDAGDDDP 315 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 831,173 Number of Sequences: 2352 Number of extensions: 16386 Number of successful extensions: 75 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -