BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A08 (875 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_55379| Best HMM Match : SAM_2 (HMM E-Value=3e-05) 29 6.5 SB_52408| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) 28 8.6 SB_39819| Best HMM Match : Extensin_2 (HMM E-Value=1) 28 8.6 SB_24031| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 29.5 bits (63), Expect = 3.7 Identities = 22/61 (36%), Positives = 30/61 (49%) Frame = +1 Query: 502 SVTPKTKPARKSPGSLPPCWKTTEFTSRSCPPRTNST*SSITRKVLXMTVSSTVIAPXTP 681 S++P + R S GSL P +T+ TSRS PR+ S + + ST P TP Sbjct: 179 SISPASPALRSSLGSLAPTSRTSTPTSRS-TPRSRS-----RSRARTPSTPSTPSTPSTP 232 Query: 682 S 684 S Sbjct: 233 S 233 >SB_55379| Best HMM Match : SAM_2 (HMM E-Value=3e-05) Length = 1088 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 78 FQSXPLRQAAPXFVLPSSSPCVRWLLTPHLHQ 173 F PLRQ + +LP S PC R +P +HQ Sbjct: 974 FADRPLRQFSEDVLLPPSLPCFR---SPRVHQ 1002 >SB_52408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/63 (22%), Positives = 28/63 (44%) Frame = +2 Query: 410 DLHRADCQAHKQKGPSRPQVDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQQSLLQDH 589 DLH + Q +Q G + + + QQ ++ Q+Q QQ+ L + + + L Sbjct: 558 DLHEEEVQHQQQFGLQEQSLGQEQRKQQQQLQQQQQQKQQQQLQKKQQKQSSMEEKLSSE 617 Query: 590 VHR 598 + + Sbjct: 618 IEK 620 >SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) Length = 458 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 511 PKTKPARKSPGSLPPCWKTTEFTSRSCPPRTNST 612 P TK PP K T + R CPP T T Sbjct: 136 PLTKCTNYRKRRCPPLTKCTNYRKRRCPPLTKCT 169 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 511 PKTKPARKSPGSLPPCWKTTEFTSRSCPPRTNST 612 P TK PP K T + R CPP T T Sbjct: 150 PLTKCTNYRKRRCPPLTKCTNYRKRRCPPLTKCT 183 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 511 PKTKPARKSPGSLPPCWKTTEFTSRSCPPRTNST 612 P TK PP K T + R CPP T T Sbjct: 164 PLTKCTNYRKRRCPPLTKCTNYRKRRCPPLTKCT 197 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 511 PKTKPARKSPGSLPPCWKTTEFTSRSCPPRTNST 612 P TK PP K T + R CPP T T Sbjct: 178 PLTKCTNYRKRRCPPLTKCTNYRKRRCPPLTRCT 211 >SB_39819| Best HMM Match : Extensin_2 (HMM E-Value=1) Length = 259 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 511 PKTKPARKSPGSLPPCWKTTEFTSRSCPPRTNST 612 P TK PP K T + R CPP T T Sbjct: 189 PLTKCTNYRKRRCPPLTKCTNYRKRRCPPLTRCT 222 >SB_24031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1176 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 512 QRQNQQESLLEVYPRVGKQQSLLQDHVHRGP 604 Q+Q QQ+ +++ + GK Q L H+ +GP Sbjct: 536 QQQEQQQQIMQKQQKQGKLQEQLGQHLTQGP 566 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,073,811 Number of Sequences: 59808 Number of extensions: 377404 Number of successful extensions: 958 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 956 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2490695009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -