BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A08 (875 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 29 0.25 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 28.7 bits (61), Expect = 0.25 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +2 Query: 431 QAHKQKGPSRPQVDRPTKPQQNCIR*LQRQNQQESLLEVYPRVGKQ-QSLL 580 Q +Q+ RPQ RP + + R QR+ + L+EV P G+ +SLL Sbjct: 463 QQPQQQQQQRPQQQRPQQQRPQQQRSQQRKPAKPELIEVSPNEGQDWESLL 513 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,492 Number of Sequences: 2352 Number of extensions: 13104 Number of successful extensions: 36 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -