BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A08 (875 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 22 6.5 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 22 8.5 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 22 8.5 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 22 8.5 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.2 bits (45), Expect = 6.5 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = -1 Query: 626 VIELQVLLVLGGHDLEVNSVVFQHGGKLPGD 534 VI + ++V +L+ +V+F+HG ++P + Sbjct: 3 VIAILAMVVGVQAELKQINVIFRHGDRIPDE 33 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.8 bits (44), Expect = 8.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 236 AIAXCSEYLKEKKGXVIKEAVKRLIEN 316 A+A + +K+ VIK+ +K L+EN Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN 97 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.8 bits (44), Expect = 8.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 236 AIAXCSEYLKEKKGXVIKEAVKRLIEN 316 A+A + +K+ VIK+ +K L+EN Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN 97 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.8 bits (44), Expect = 8.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 236 AIAXCSEYLKEKKGXVIKEAVKRLIEN 316 A+A + +K+ VIK+ +K L+EN Sbjct: 71 ALATDCKKCTDKQREVIKKVIKFLVEN 97 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,532 Number of Sequences: 438 Number of extensions: 3333 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28402218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -