BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A07 (830 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 30 0.020 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 30 0.020 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 23 3.0 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 3.9 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 30.3 bits (65), Expect = 0.020 Identities = 15/58 (25%), Positives = 23/58 (39%) Frame = +2 Query: 344 YHRXVPGLTXXFEVYVAKXXICNAYTELNDPATQREXFEEQAXNRAAGDDETPPTDEA 517 YH PG + +++ C Y E D + + + GD TPP D+A Sbjct: 617 YHAVAPGTDIRQSIALSRKKKCIRYMEAGDGNDGNQSDDNLGSCGSMGDAHTPPEDDA 674 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 30.3 bits (65), Expect = 0.020 Identities = 15/58 (25%), Positives = 23/58 (39%) Frame = +2 Query: 344 YHRXVPGLTXXFEVYVAKXXICNAYTELNDPATQREXFEEQAXNRAAGDDETPPTDEA 517 YH PG + +++ C Y E D + + + GD TPP D+A Sbjct: 509 YHAVAPGTDIRQSIALSRKKKCIRYMEAGDGNDGNQSDDNLGSCGSMGDAHTPPEDDA 566 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 569 GVDRLTMFLTDSNNIKEVLL 628 GVD L FLT + ++EV++ Sbjct: 650 GVDTLQQFLTPNMRVQEVVI 669 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 569 GVDRLTMFLTDSNNIKEVLLFPXNEA**PKQK 664 GVD L FLT + +++V + + PKQ+ Sbjct: 651 GVDTLQQFLTPNMRVQDVTIKFSDRTVRPKQR 682 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,299 Number of Sequences: 336 Number of extensions: 2677 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22829180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -