BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A05 (874 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC044246-1|AAH44246.1| 491|Homo sapiens KIAA1913 protein protein. 32 3.1 AL137251-1|CAI19564.1| 491|Homo sapiens KIAA1913 protein. 32 3.1 AB067500-1|BAB67806.1| 509|Homo sapiens KIAA1913 protein protein. 32 3.1 AB052099-1|BAD05135.1| 491|Homo sapiens HBE61 protein. 32 3.1 >BC044246-1|AAH44246.1| 491|Homo sapiens KIAA1913 protein protein. Length = 491 Score = 31.9 bits (69), Expect = 3.1 Identities = 21/73 (28%), Positives = 29/73 (39%) Frame = +3 Query: 537 YMFKQKVGASLSAXXSDVIXRNDYSXGGXLNLFRSPSSSLDFNAGFRSLIRLFXDLRGSP 716 Y +G S R + L+L S S SLD + G S + + + R P Sbjct: 359 YKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRG-PSTLTVQAEQRKHP 417 Query: 717 XWDSPSRNSSKKY 755 W RN+SK Y Sbjct: 418 SWPRLDRNNSKGY 430 >AL137251-1|CAI19564.1| 491|Homo sapiens KIAA1913 protein. Length = 491 Score = 31.9 bits (69), Expect = 3.1 Identities = 21/73 (28%), Positives = 29/73 (39%) Frame = +3 Query: 537 YMFKQKVGASLSAXXSDVIXRNDYSXGGXLNLFRSPSSSLDFNAGFRSLIRLFXDLRGSP 716 Y +G S R + L+L S S SLD + G S + + + R P Sbjct: 359 YKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRG-PSTLTVQAEQRKHP 417 Query: 717 XWDSPSRNSSKKY 755 W RN+SK Y Sbjct: 418 SWPRLDRNNSKGY 430 >AB067500-1|BAB67806.1| 509|Homo sapiens KIAA1913 protein protein. Length = 509 Score = 31.9 bits (69), Expect = 3.1 Identities = 21/73 (28%), Positives = 29/73 (39%) Frame = +3 Query: 537 YMFKQKVGASLSAXXSDVIXRNDYSXGGXLNLFRSPSSSLDFNAGFRSLIRLFXDLRGSP 716 Y +G S R + L+L S S SLD + G S + + + R P Sbjct: 377 YKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRG-PSTLTVQAEQRKHP 435 Query: 717 XWDSPSRNSSKKY 755 W RN+SK Y Sbjct: 436 SWPRLDRNNSKGY 448 >AB052099-1|BAD05135.1| 491|Homo sapiens HBE61 protein. Length = 491 Score = 31.9 bits (69), Expect = 3.1 Identities = 21/73 (28%), Positives = 29/73 (39%) Frame = +3 Query: 537 YMFKQKVGASLSAXXSDVIXRNDYSXGGXLNLFRSPSSSLDFNAGFRSLIRLFXDLRGSP 716 Y +G S R + L+L S S SLD + G S + + + R P Sbjct: 359 YKSSMALGPGAGQLLSPGAARRQFGSNTSLHLLSSHSKSLDLDRG-PSTLTVQAEQRKHP 417 Query: 717 XWDSPSRNSSKKY 755 W RN+SK Y Sbjct: 418 SWPRLDRNNSKGY 430 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,079,016 Number of Sequences: 237096 Number of extensions: 1499856 Number of successful extensions: 14342 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14341 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11104084400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -