BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A05 (874 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64360.3 68418.m08085 DNAJ heat shock N-terminal domain-conta... 28 7.1 At5g64360.2 68418.m08084 DNAJ heat shock N-terminal domain-conta... 28 7.1 At5g64360.1 68418.m08083 DNAJ heat shock N-terminal domain-conta... 28 7.1 At3g32940.1 68416.m04174 expressed protein 28 9.4 >At5g64360.3 68418.m08085 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226 DnaJ domain Length = 464 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -1 Query: 286 SADPMALSTFLSLPVRGTFRAAPEVPSEFTVKLPACLRARVGTXLP 149 SADPMA S + + P P+ E T+K C RA +P Sbjct: 187 SADPMATSFWTACPYCFVLFEYPKAYEECTLKCQECRRAFQAVTIP 232 >At5g64360.2 68418.m08084 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226 DnaJ domain Length = 464 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -1 Query: 286 SADPMALSTFLSLPVRGTFRAAPEVPSEFTVKLPACLRARVGTXLP 149 SADPMA S + + P P+ E T+K C RA +P Sbjct: 187 SADPMATSFWTACPYCFVLFEYPKAYEECTLKCQECRRAFQAVTIP 232 >At5g64360.1 68418.m08083 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226 DnaJ domain Length = 422 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = -1 Query: 286 SADPMALSTFLSLPVRGTFRAAPEVPSEFTVKLPACLRARVGTXLP 149 SADPMA S + + P P+ E T+K C RA +P Sbjct: 187 SADPMATSFWTACPYCFVLFEYPKAYEECTLKCQECRRAFQAVTIP 232 >At3g32940.1 68416.m04174 expressed protein Length = 607 Score = 27.9 bits (59), Expect = 9.4 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -2 Query: 576 PRSTMRPPSV*TCSPLRRPSVL 511 PRST+RP ++ T P+ RP++L Sbjct: 371 PRSTVRPSTLFTFHPVHRPTLL 392 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,332,565 Number of Sequences: 28952 Number of extensions: 199635 Number of successful extensions: 400 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 400 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2048424000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -