BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP04_F_A03 (843 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0577 + 4261249-4262055,4262149-4262203,4262293-4262468,426... 32 0.66 03_01_0525 + 3952095-3952217,3953131-3953614,3953695-3953750,395... 28 8.1 >03_01_0577 + 4261249-4262055,4262149-4262203,4262293-4262468, 4262554-4262718,4262811-4263178,4263225-4263861, 4263952-4265844,4266325-4266672 Length = 1482 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -2 Query: 563 SLCXSGAXQGSENADIDSTRLSTRQPSRVM*VILSVPQTGLYSAVTGQL 417 +LC G+ G+ N +D + S++M VIL + Q +Y A T L Sbjct: 1108 ALCAQGSVVGTFNRALDGPAAKASRRSQLMGVILGLSQGAMYGAYTATL 1156 >03_01_0525 + 3952095-3952217,3953131-3953614,3953695-3953750, 3953942-3954018,3954862-3954958,3955274-3955407, 3955760-3955825,3955954-3956044 Length = 375 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 453 TNWIVLSGYWAATNALLNCRRHCGGAQIV 367 T WI YWA N L NC H G Q V Sbjct: 17 TLWIGDLQYWADENYLYNCFAHTGELQSV 45 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,551,922 Number of Sequences: 37544 Number of extensions: 245326 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2338704516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -