BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P24 (896 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 24 1.9 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 3.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 3.2 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 5.7 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 9.9 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 23.8 bits (49), Expect = 1.9 Identities = 13/48 (27%), Positives = 14/48 (29%) Frame = +3 Query: 693 PPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPPXXXPPLSFP 836 P P P P P PP P P PP P + P Sbjct: 149 PKYEPNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPPIFPPTMINP 196 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 521 PXPXXXPPPXPPPXPP 568 P P P P PP PP Sbjct: 176 PLPQVPPLPLPPIFPP 191 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/33 (33%), Positives = 11/33 (33%) Frame = +2 Query: 521 PXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXL 619 P P P P PP P PGP L Sbjct: 226 PTGLIPPHPGLSPHPPHLSSHPAIVTPGPKQEL 258 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/33 (33%), Positives = 11/33 (33%) Frame = +2 Query: 521 PXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXL 619 P P P P PP P PGP L Sbjct: 118 PTGLIPPHPGLSPHPPHLSSHPAIVTPGPKQEL 150 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +3 Query: 360 NRLICNYLSAFCNFLFNHQHSS 425 +R +++ +C FL+N HS+ Sbjct: 131 HRYTLSFIENYCQFLYNCFHST 152 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 721 PXPPPXXPXPPP 756 P P P P PPP Sbjct: 205 PEPVPSTPYPPP 216 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,393 Number of Sequences: 336 Number of extensions: 5735 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -