BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P24 (896 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 51 3e-07 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 47 3e-06 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 44 2e-05 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 43 7e-05 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 37 0.003 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 36 0.006 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 36 0.006 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 32 0.096 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 31 0.17 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 31 0.22 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 28 1.6 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 28 1.6 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 27 2.7 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 23 3.3 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 27 3.6 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 26 6.3 SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb... 26 8.4 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 50.8 bits (116), Expect = 3e-07 Identities = 33/135 (24%), Positives = 34/135 (25%), Gaps = 1/135 (0%) Frame = +3 Query: 495 PPPXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGPP-XSSXXGXPXXXPPPKKKPXX 671 P P P P P P P P P P PP P P P Sbjct: 1065 PVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVP 1124 Query: 672 XXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPPXXXPPLSFPXXXGX 851 PP P P P P P P P PP P P Sbjct: 1125 KPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKP 1184 Query: 852 GGGXXPLLXPPXPPP 896 G P+ P PP Sbjct: 1185 AAGVPPVPPPSEAPP 1199 Score = 48.8 bits (111), Expect = 1e-06 Identities = 38/137 (27%), Positives = 38/137 (27%), Gaps = 4/137 (2%) Frame = +1 Query: 496 PPPXP-PXXXXXXXXXPXXXPP-PPPXXXPXXPXXXXXAPPXPXXXGXXXXXPXPK-KNP 666 PPP P P P PP P P P P APP P P P P Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Query: 667 XXXPXXXXPPPXXXXPXXPXPPPXXPXPP-PXXXXXPPXPXPPXXXXPPXXXPPXXFXXX 843 P PP P P P PP P PP P P PP P Sbjct: 1123 VPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVP-KPSVAAPPVPAPSSGIPPV 1181 Query: 844 XXGGGXXXPSSPXXPPP 894 P P P Sbjct: 1182 PKPAAGVPPVPPPSEAP 1198 Score = 48.8 bits (111), Expect = 1e-06 Identities = 36/140 (25%), Positives = 39/140 (27%) Frame = +3 Query: 477 PXXTXXPPPXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGPPXSSXXGXPXXXPPPK 656 P P P P P P P P P P PP + G P P Sbjct: 1107 PSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSV 1166 Query: 657 KKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPPXXXPPLSFP 836 P P P P P P P PP PP P P P PP + P Sbjct: 1167 AAP------PVPAPSSGIPPVPKPAAGVPPVPP-PSEAPPVPKPSVGV--PPVPPPSTAP 1217 Query: 837 XXXGXGGGXXPLLXPPXPPP 896 G P+ P P Sbjct: 1218 PVPTPSAGLPPVPVPTAKAP 1237 Score = 44.4 bits (100), Expect = 2e-05 Identities = 40/144 (27%), Positives = 42/144 (29%), Gaps = 4/144 (2%) Frame = +3 Query: 477 PXXTXXPP-PXPXXPXPXXPXXPXXXPP-PXPXXXXPXPXXXXXGPPXSSXXGXPXXXPP 650 P + PP P P P P PP P P P P PP G P P Sbjct: 1086 PAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAP---PV 1142 Query: 651 PKKKPXXXXXXXXPPPXXXXPXXPXPXPX--XPXXPPXXXXXPPXPPPPXXXXPPXXXPP 824 PK PP P P P P P PP P P P PP Sbjct: 1143 PKPS------VAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGV--PPVPPP 1194 Query: 825 LSFPXXXGXGGGXXPLLXPPXPPP 896 P G P+ P PP Sbjct: 1195 SEAPPVPKPSVGVPPVPPPSTAPP 1218 Score = 43.2 bits (97), Expect = 5e-05 Identities = 28/117 (23%), Positives = 29/117 (24%) Frame = +2 Query: 473 KPPXXXPXPPXXXXXXPXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXLXXGXPXPXPPX 652 KP P P P P P P P P P PP G P P Sbjct: 1106 KPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPS 1165 Query: 653 QKKTXXXXXXXXPPPPXXXXXXXPXXPXXTXXPPXXXXXXPXXPXPPXXXPPPXXXP 823 PP P P + PP P PP PP P Sbjct: 1166 VAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTP 1222 Score = 42.3 bits (95), Expect = 9e-05 Identities = 41/151 (27%), Positives = 44/151 (29%), Gaps = 11/151 (7%) Frame = +3 Query: 477 PXXTXXPPPXPXXPXPXXPXXPXXXPP-PXPXXXXPXPXXXXXGPPXSSXXGXPXXXPP- 650 P P P P P PP P P P P P S G P PP Sbjct: 1007 PLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPV 1066 Query: 651 --PKKK-PXXXXXXXXPP--PXXXXPXXPXPXPXXPXXPPXXXXXPPXPPP---PXXXXP 806 P + P PP P P P P P PP P P P P Sbjct: 1067 PAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKP 1126 Query: 807 PXXXPPLSFPXXXGXGGGXXP-LLXPPXPPP 896 PP+ P G P + PP P P Sbjct: 1127 SVAAPPV--PVPSGAPPVPKPSVAAPPVPAP 1155 Score = 39.9 bits (89), Expect = 5e-04 Identities = 33/139 (23%), Positives = 35/139 (25%), Gaps = 5/139 (3%) Frame = +3 Query: 495 PPPXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGP----PXSSXXGXPXXXPPPKKK 662 P P P P P P P P P P P P + P P Sbjct: 1023 PVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGA 1082 Query: 663 PXXXXXXXXPP-PXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPPXXXPPLSFPX 839 P PP P P P P P P P P PP P P Sbjct: 1083 PPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPS-GAPP 1141 Query: 840 XXGXGGGXXPLLXPPXPPP 896 P+ P PP Sbjct: 1142 VPKPSVAAPPVPAPSGAPP 1160 Score = 39.1 bits (87), Expect = 8e-04 Identities = 35/141 (24%), Positives = 37/141 (26%), Gaps = 7/141 (4%) Frame = +3 Query: 495 PPPXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXG--PPXSSXXGXPXXXPPP-KKKP 665 P P P P PPP P P PP + G P P P Sbjct: 1044 PIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPP 1103 Query: 666 XXXXXXXXPPPXXXXPXXPXPXPXXPXXP-PXXXXXPPXPPPPXXXXP---PXXXPPLSF 833 PP P P P P P PP P P P P PP+ Sbjct: 1104 VPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPK 1163 Query: 834 PXXXGXGGGXXPLLXPPXPPP 896 P PP P P Sbjct: 1164 PSVAAPPVPAPSSGIPPVPKP 1184 Score = 37.5 bits (83), Expect = 0.003 Identities = 30/141 (21%), Positives = 32/141 (22%), Gaps = 1/141 (0%) Frame = +2 Query: 473 KPPXXXPXPPXXXXXXPXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXLXXGXPXPXPPX 652 KP P P P P P P P P P PP P P Sbjct: 1125 KPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKP 1184 Query: 653 QKKTXXXXXXXXPPPPXXXXXXXPXXPXXTXXPPXXXXXXPXXPXP-PXXXPPPXXXPPX 829 PP P P + PP P P P PP P Sbjct: 1185 AAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSS 1244 Query: 830 XSXXGGXGGGXXPPPXPXXPP 892 + P P P Sbjct: 1245 EAPSVSTPRSSVPSPHSNASP 1265 Score = 37.1 bits (82), Expect = 0.003 Identities = 27/100 (27%), Positives = 27/100 (27%), Gaps = 9/100 (9%) Frame = +1 Query: 553 PPPPPXXXPXXPXXXXXAPPXPXXXGXXXXXPXPKKNPXXXPXXXXPPPXXXXPXXPXPP 732 P P P P APP P P P P PP P P Sbjct: 1004 PAAPLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAP 1063 Query: 733 PXXPXPP------PXXXXXPPXPXP---PXXXXPPXXXPP 825 P P P P PP P P P P PP Sbjct: 1064 PPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPP 1103 Score = 33.9 bits (74), Expect = 0.032 Identities = 33/139 (23%), Positives = 33/139 (23%) Frame = +2 Query: 479 PXXXPXPPXXXXXXPXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXLXXGXPXPXPPXQK 658 P P P P PP PP P P P P P P Sbjct: 966 PPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTS--PAAPL----ARVPPVPKLSS 1019 Query: 659 KTXXXXXXXXPPPPXXXXXXXPXXPXXTXXPPXXXXXXPXXPXPPXXXPPPXXXPPXXSX 838 K PP P P T PP P PPP P Sbjct: 1020 KAPPVPLPSADAPPIPVPSTAPPVPIPTSTPP-----VPKSSSGAPSAPPPVPAPSSEIP 1074 Query: 839 XGGXGGGXXPPPXPXXPPP 895 G P P P PP Sbjct: 1075 SIPAPSGAPPVPAPSGIPP 1093 Score = 33.5 bits (73), Expect = 0.042 Identities = 35/140 (25%), Positives = 36/140 (25%), Gaps = 8/140 (5%) Frame = +3 Query: 501 PXPXXPXPXXPXXPXXXPPPXPXXXXPX--PXXXXXGPPXSSXXGXPXXXPPP------K 656 P P P P P P P P P S+ P PP K Sbjct: 961 PRPAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSK 1020 Query: 657 KKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPPXXXPPLSFP 836 P PP P P P P P PPP P P S P Sbjct: 1021 APPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPP-VPAPSSEIP--SIP 1077 Query: 837 XXXGXGGGXXPLLXPPXPPP 896 G P PP P P Sbjct: 1078 APSGAPPVPAPSGIPPVPKP 1097 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 47.2 bits (107), Expect = 3e-06 Identities = 26/77 (33%), Positives = 27/77 (35%) Frame = +2 Query: 467 QHKPPXXXPXPPXXXXXXPXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXLXXGXPXPXP 646 Q K P PP P P P P PPP P P P PP PP G P P P Sbjct: 724 QQKLLLKSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPP---PPPPPGVAGAGPPPPPP 780 Query: 647 PXQKKTXXXXXXXXPPP 697 P + P P Sbjct: 781 PPPAVSAGGSRYYAPAP 797 Score = 38.3 bits (85), Expect = 0.001 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 551 PPPXPPXXXPXPXXXP-PGPPXXLXXGXPXPXPPXQKKTXXXXXXXXPPPP 700 PPP P P P P P PP G P P PP PPPP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 36.3 bits (80), Expect = 0.006 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +3 Query: 690 PPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPPXXXPPLSFPXXXGXGGGXXP 869 PPP P P P P PP PPPP PP P GG Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYY 793 Query: 870 LLXPPXPP 893 P P Sbjct: 794 APAPQAEP 801 Score = 35.9 bits (79), Expect = 0.008 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 491 PXPPXXXXXXPXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXLXXGXPXPXPPXQ 655 P P P P PP PPP P P PP PP G P Q Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAPQ 798 Score = 34.3 bits (75), Expect = 0.024 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +1 Query: 478 PXXXPXPPPXPPXXXXXXXXXPXXXPPPPPXXXPXXPXXXXXAPPXPXXXGXXXXXPXPK 657 P P P P PP P PPPPP P PP G P P+ Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPP---PPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAPQ 798 Query: 658 KNP 666 P Sbjct: 799 AEP 801 Score = 33.5 bits (73), Expect = 0.042 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 721 PXPPPXXPXPPPXXXXXPPXPXPPXXXXPPXXXPPXXFXXXXXGGGXXXPSSPXXPPP 894 P PPP P P P P P PP PP G P P PPP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPP-------PGVAGAGPPPPPPPPP 783 Score = 32.3 bits (70), Expect = 0.096 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 607 PPXPXXXGXXXXXPXPKKNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPP 756 PP P P P P P PPP P P P PPP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 31.5 bits (68), Expect = 0.17 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 655 KKNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXPPXPXPPXXXXPPXXXPP 825 K P P P P P P P PPP PP P PP PP Sbjct: 730 KSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPP----PPPPPGVAGAGPPPPPPPP 782 Score = 31.1 bits (67), Expect = 0.22 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +3 Query: 648 PPKKKPXXXXXXXXPPPXXXXPXXPXPX-PXXPXXPPXXXXXPPXPPPP 791 PP P P P P P P P PP P PPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 29.9 bits (64), Expect = 0.51 Identities = 20/73 (27%), Positives = 20/73 (27%), Gaps = 4/73 (5%) Frame = +2 Query: 689 PPPPXXXXXXXPXXPXXTXXPPXXXXXXPXXPXPPXXX----PPPXXXPPXXSXXGGXGG 856 PPPP P PP P P PP PPP PP G Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPA--VSAGGS 790 Query: 857 GXXPPPXPXXPPP 895 P P P Sbjct: 791 RYYAPAPQAEPEP 803 Score = 29.9 bits (64), Expect = 0.51 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +1 Query: 652 PKKNPXXXPXXXXPPPXXXXPXXP--XPPPXXPXPPPXXXXXPPXPXPP 792 P P P P P P PP P PP PP P PP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +3 Query: 633 PXXXPPPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPP 788 P PP P PP P P P P PP PPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 26.6 bits (56), Expect = 4.8 Identities = 14/50 (28%), Positives = 14/50 (28%) Frame = +3 Query: 606 PPXSSXXGXPXXXPPPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPP 755 PP P P P P PPP P P P PP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 44.4 bits (100), Expect = 2e-05 Identities = 33/91 (36%), Positives = 33/91 (36%), Gaps = 1/91 (1%) Frame = -2 Query: 895 GGGXGGXRRG-XXPPPXPXXXGXXRGGXXXGGXXXXGGGGXGGXXXXXGGXXGXXGXGXG 719 GGG GG G PPP P G GG G G GG GG G G G G G Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGF-GGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPG 245 Query: 718 XXGXXXXGGGXXXXXXXXGFFLGGGXXXGXP 626 GGG G F GG G P Sbjct: 246 -----GFGGGLGGFGGGPGGFGGGPGGHGGP 271 Score = 39.1 bits (87), Expect = 8e-04 Identities = 34/109 (31%), Positives = 34/109 (31%), Gaps = 4/109 (3%) Frame = -1 Query: 791 GGXGXGGXXXXXGGGX----GXXGGGXGXXGXXXXGGGXXXXGXXXGFFFGXGXXXXXPX 624 GG GG G G GGG G G GG G GF G Sbjct: 164 GGLALGGLASHALGNLFHHRGHNGGGFGGFGGGS-GGPPPGPGGFGGFGGFGGEGHHHGG 222 Query: 623 XXGXGGAXXXXXGXXGXXXGGGGGXXXGXXXXXXXXXGGXGGGXGXXXG 477 G GG G G GG GG G GG GGG G G Sbjct: 223 HGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGP-GGFGGGPGGHGG 270 Score = 36.3 bits (80), Expect = 0.006 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = -2 Query: 808 GGXXXXGGGGXGGXXXXXGGXXGXXGXGXGXX---GXXXXGGGXXXXXXXXGFFLGGGXX 638 GG GGG GG GG G G G G GGG G F GG Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGG 246 Query: 637 XGXPXXEXXGGPXXXXXGXG 578 G GGP G G Sbjct: 247 FGGGLGGFGGGPGGFGGGPG 266 Score = 36.3 bits (80), Expect = 0.006 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 648 GGXGXGXPXXRXXGGPGGXXXGXGXXXGGXGGGXGGGXXXGXGXXXXXWGGXGXXXGGL 472 GG G P GG GG G G GG GG GGG G GG G GGL Sbjct: 195 GGSGGPPPGPGGFGGFGGFG-GEGHHHGGHGG-FGGGPGGFEGGPGGFGGGPGGFGGGL 251 Score = 34.7 bits (76), Expect = 0.018 Identities = 37/113 (32%), Positives = 37/113 (32%) Frame = -3 Query: 894 GGGXXGXGGGXXPPPXPPXXEXXGGXXXGGGXXXGGXGXXGXXXXXXGGXXVXXGXXGXX 715 GGG G GGG PP P G G G GG G G GG G G Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFG------GGPGGFEGGPGGF 240 Query: 714 XXXXXGGGGXXXXXXXXVFFWXGGXGXGXPXXRXXGGPGGXXXGXGXXXGGXG 556 G GG GG G GGPGG G G GG G Sbjct: 241 GGGPGGFGGGL-----------GGFG---------GGPGGFGGGPG-GHGGPG 272 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 42.7 bits (96), Expect = 7e-05 Identities = 40/149 (26%), Positives = 42/149 (28%), Gaps = 6/149 (4%) Frame = +3 Query: 468 NTNPXXTXXPPPXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGPPXSSXXGXPXXXP 647 ++N PPP P P P P P PP SS Sbjct: 331 SSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPA 390 Query: 648 PPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPP-XXXXXPPXPPPPXXXXPPXXXP- 821 PP P PP P P P PP PP PP P P Sbjct: 391 PPPAIP-GRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPL 449 Query: 822 PLSFPXXXGXGGG--XXPLLXP--PXPPP 896 P S P G P L P P PPP Sbjct: 450 PPSAPIAPPLPAGMPAAPPLPPAAPAPPP 478 Score = 37.9 bits (84), Expect = 0.002 Identities = 26/95 (27%), Positives = 27/95 (28%) Frame = +1 Query: 499 PPXPPXXXXXXXXXPXXXPPPPPXXXPXXPXXXXXAPPXPXXXGXXXXXPXPKKNPXXXP 678 P PP P P PP P P + P G P P P Sbjct: 401 PALPPLGNASRTSTPPV--PTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAP---- 454 Query: 679 XXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXPPXP 783 PP P P PP P PPP P P Sbjct: 455 --IAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 37.1 bits (82), Expect = 0.003 Identities = 34/135 (25%), Positives = 36/135 (26%), Gaps = 1/135 (0%) Frame = +2 Query: 491 PXPPXXXXXXPXPXXXPPPXPP-PXPPXXXPXPXXXPPGPPXXLXXGXPXPXPPXQKKTX 667 P PP P P P PP PP PP + G P P Sbjct: 352 PLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAI-PGRSAPALPPLGNAS 410 Query: 668 XXXXXXXPPPPXXXXXXXPXXPXXTXXPPXXXXXXPXXPXPPXXXPPPXXXPPXXSXXGG 847 P PP P P PP P P P P PP + G Sbjct: 411 RTSTPPVPTPPSLPPSAPPSLPPSA--PPSLPMGAPAAPPLP---PSAPIAPPLPA--GM 463 Query: 848 XGGGXXPPPXPXXPP 892 PP P PP Sbjct: 464 PAAPPLPPAAPAPPP 478 Score = 35.9 bits (79), Expect = 0.008 Identities = 32/128 (25%), Positives = 32/128 (25%), Gaps = 12/128 (9%) Frame = +1 Query: 478 PXXXPXPPPXPPXXXXXXXXXPXXXPPP-----PPXXXPXXPXXXXXAPPXPXXXGXXXX 642 P PPP PP P PP P P A P Sbjct: 355 PQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTST 414 Query: 643 XPXPK------KNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXP-PXPXPPXXX 801 P P P P P P P PP P PP P P PP Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAP 474 Query: 802 XPPXXXPP 825 PP P Sbjct: 475 APPPAPAP 482 Score = 34.3 bits (75), Expect = 0.024 Identities = 33/143 (23%), Positives = 33/143 (23%), Gaps = 9/143 (6%) Frame = +3 Query: 495 PPPXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGPPXSSXXGXPXXXPPPKKKPXXX 674 PPP PPP P P G P PPP P Sbjct: 293 PPPSSRVSAAALAANKKRPPPPPP------PSRRNRGKPPIGNGSSNSSLPPPPPPPRSN 346 Query: 675 XXXXXPPPXXXXPXXPXPXP---------XXPXXPPXXXXXPPXPPPPXXXXPPXXXPPL 827 P P P P P P PP PPP PPL Sbjct: 347 AAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPL 406 Query: 828 SFPXXXGXGGGXXPLLXPPXPPP 896 P PP PP Sbjct: 407 GNASRTSTPPVPTPPSLPPSAPP 429 Score = 33.5 bits (73), Expect = 0.042 Identities = 29/116 (25%), Positives = 30/116 (25%), Gaps = 5/116 (4%) Frame = +2 Query: 491 PXPPXXXXXXPXPXXXPPPXP----PPXPPXXXPXPXXXPPGP-PXXLXXGXPXPXPPXQ 655 P P P PP P P PP PP P P L P PP Sbjct: 376 PPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSA 435 Query: 656 KKTXXXXXXXXPPPPXXXXXXXPXXPXXTXXPPXXXXXXPXXPXPPXXXPPPXXXP 823 + PP P P PP P P PP P P Sbjct: 436 PPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPP----LPPAAPAPPPAPAPAPAAP 487 Score = 31.5 bits (68), Expect = 0.17 Identities = 29/120 (24%), Positives = 30/120 (25%), Gaps = 3/120 (2%) Frame = +2 Query: 545 PXPPPXPPXXXPXPXXXPPGPPXXLXXGXPXPXPPXQKKTXXXXXXXXPPPPXXXXXXXP 724 P PP P PP L P P PP T PP P P Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGT-VSSPPNSPPRPIAPVSMNP 282 Query: 725 XXPXXTXXP-PXXXXXXPXXPXPPXXXPPPXXXPPXXSXXG--GXGGGXXPPPXPXXPPP 895 + P P PP PP G G G P PPP Sbjct: 283 AINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPP 342 Score = 30.7 bits (66), Expect = 0.29 Identities = 34/140 (24%), Positives = 35/140 (25%) Frame = +3 Query: 477 PXXTXXPPPXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGPPXSSXXGXPXXXPPPK 656 P T PP P P P P P P PP S P P Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNS----PPRPIAPVS 279 Query: 657 KKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPPXXXPPLSFP 836 P P P P PP PPPP PP+ Sbjct: 280 MNPAINSTSKPPLP-------PPSSRVSAAALAANKKRPPPPPPPSRRN--RGKPPIG-- 328 Query: 837 XXXGXGGGXXPLLXPPXPPP 896 G L PP PPP Sbjct: 329 -----NGSSNSSLPPPPPPP 343 Score = 28.7 bits (61), Expect = 1.2 Identities = 30/144 (20%), Positives = 32/144 (22%), Gaps = 2/144 (1%) Frame = +1 Query: 469 TQTPXXXPXPPPXPPXXXXXXXXXPXXXPPPPPXXXP--XXPXXXXXAPPXPXXXGXXXX 642 T T P PP P P PPP P +PP P Sbjct: 223 TPTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNP 282 Query: 643 XPXPKKNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXPPXPXPPXXXXPPXXXP 822 P P PPP P P PP P Sbjct: 283 AINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPP 342 Query: 823 PXXFXXXXXGGGXXXPSSPXXPPP 894 P S+P PPP Sbjct: 343 PRSNAAGSIPLPPQGRSAPPPPPP 366 Score = 27.9 bits (59), Expect = 2.1 Identities = 27/123 (21%), Positives = 30/123 (24%), Gaps = 5/123 (4%) Frame = +3 Query: 477 PXXTXXPPPXPXXPXPXXPXXPXXXPPPXPXXXXPX-PXXXXXG----PPXSSXXGXPXX 641 P PPP P P PP P P P PP + P Sbjct: 370 PSTGRQPPPLSSSRAVSNPPAP---PPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPS 426 Query: 642 XPPPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPPXXXP 821 PP P P P P P PP P P P Sbjct: 427 APPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAA 486 Query: 822 PLS 830 P++ Sbjct: 487 PVA 489 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 37.1 bits (82), Expect = 0.003 Identities = 35/141 (24%), Positives = 37/141 (26%) Frame = +2 Query: 467 QHKPPXXXPXPPXXXXXXPXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXLXXGXPXPXP 646 +H PP P P P PP P P P PP G P P Sbjct: 205 EHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPP--PPMHHEPGEHMPPP 262 Query: 647 PXQKKTXXXXXXXXPPPPXXXXXXXPXXPXXTXXPPXXXXXXPXXPXPPXXXPPPXXXPP 826 P + PPPP P PP P PP P PP Sbjct: 263 PMHHE----PGEHMPPPPMHHEPGEHMPP-----PPMHHEPGEHMPPPPMHHEPGEHMPP 313 Query: 827 XXSXXGGXGGGXXPPPXPXXP 889 G PPP P Sbjct: 314 PPMHH-EPGEHMPPPPMHHEP 333 Score = 36.3 bits (80), Expect = 0.006 Identities = 36/143 (25%), Positives = 38/143 (26%), Gaps = 11/143 (7%) Frame = +3 Query: 501 PXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGPPXSSXXGXPXXXPPPKKKPXXXXX 680 P P P P PP P P PP G PP +P Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPP--PPMHHEPGEHMPPPPMHHEPGEHMP 260 Query: 681 XXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPP--------XPPPPXXXXPPXXXPPLSFP 836 PPP P P P P PP PPPP P PP Sbjct: 261 ---PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMH 317 Query: 837 XXXGXGGGXXPLLXPP---XPPP 896 G P+ P PPP Sbjct: 318 HEPGEHMPPPPMHHEPGEHMPPP 340 Score = 35.5 bits (78), Expect = 0.010 Identities = 32/127 (25%), Positives = 33/127 (25%), Gaps = 11/127 (8%) Frame = +3 Query: 477 PXXTXXPPPXPXXPXPXXPXXPXXXPPPXPXXXXPX---PXXXXXGPPXSSXXGXPXXXP 647 P PPP P P P P P P PP G P Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 262 Query: 648 PPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPP--------XPPPPXXXX 803 P +P PPP P P P P PP PPPP Sbjct: 263 PMHHEPGEHMP---PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE 319 Query: 804 PPXXXPP 824 P PP Sbjct: 320 PGEHMPP 326 Score = 34.3 bits (75), Expect = 0.024 Identities = 28/114 (24%), Positives = 29/114 (25%), Gaps = 3/114 (2%) Frame = +3 Query: 477 PXXTXXPPPXPXXPXPXXPXXPXXXPPPXPXXXXPX---PXXXXXGPPXSSXXGXPXXXP 647 P PPP P P P P P P PP G P Sbjct: 229 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 288 Query: 648 PPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPP 809 P +P PPP P P P P PP P PP Sbjct: 289 PMHHEPGEHMP---PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPP 339 Score = 33.1 bits (72), Expect = 0.055 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = +1 Query: 541 PXXXPPPPPXXXPXXPXXXXXAPPXPXXXGXXXXXPXPKKNPXXXPXXXXPPPXXXXPXX 720 P PPPP P PP G P P PPP P Sbjct: 255 PGEHMPPPPMHHE--PGEHMPPPPMHHEPGEHMPPPPMHHEPGEH---MPPPPMHHEPGE 309 Query: 721 PXPPPXXPXPPPXXXXXPPXPXPPXXXXPP 810 PPP P PP P PP Sbjct: 310 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPP 339 Score = 32.3 bits (70), Expect = 0.096 Identities = 26/94 (27%), Positives = 27/94 (28%) Frame = +1 Query: 553 PPPPPXXXPXXPXXXXXAPPXPXXXGXXXXXPXPKKNPXXXPXXXXPPPXXXXPXXPXPP 732 PPPP P PP P P P + P PPP P P Sbjct: 260 PPPPMHHEPGE-----HMPPPPMHHEPGEHMPPPPMH--HEPGEHMPPP----PMHHEPG 308 Query: 733 PXXPXPPPXXXXXPPXPXPPXXXXPPXXXPPXXF 834 P PP P PP P PP F Sbjct: 309 EHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPF 342 Score = 29.9 bits (64), Expect = 0.51 Identities = 25/103 (24%), Positives = 26/103 (25%), Gaps = 3/103 (2%) Frame = +3 Query: 477 PXXTXXPPPXPXXPXPXXPXXPXXXPPPXPXXXXPX---PXXXXXGPPXSSXXGXPXXXP 647 P PPP P P P P P P PP G P Sbjct: 242 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 301 Query: 648 PPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPP 776 P +P PPP P P P P PP Sbjct: 302 PMHHEPGEHMP---PPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 36.3 bits (80), Expect = 0.006 Identities = 35/139 (25%), Positives = 36/139 (25%), Gaps = 1/139 (0%) Frame = +1 Query: 478 PXXXPXPPPXPPXXXXXXXXXPXXX-PPPPPXXXPXXPXXXXXAPPXPXXXGXXXXXPXP 654 P P PP P PPP P P P APP P P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSK---APPIPSSLPPPAQPAAP 180 Query: 655 KKNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXPPXPXPPXXXXPPXXXPPXXF 834 K+P P P P PPP P P PP P F Sbjct: 181 VKSPPSAP--SLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKF 238 Query: 835 XXXXXGGGXXXPSSPXXPP 891 G S P PP Sbjct: 239 --PNRGPSIPSASVPPVPP 255 Score = 33.9 bits (74), Expect = 0.032 Identities = 29/116 (25%), Positives = 29/116 (25%), Gaps = 8/116 (6%) Frame = +1 Query: 469 TQTPXXXPXPPPXP---PXXXXXXXXXPXXXPPP-----PPXXXPXXPXXXXXAPPXPXX 624 T P PPP P P P PPP P P P PP P Sbjct: 141 TSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPK 200 Query: 625 XGXXXXXPXPKKNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXPPXPXPP 792 P N P PP P P P P P PP Sbjct: 201 VPPPPLSQAPVANTSSRP-SSFAPPAGHAPNVTSESPKFPNRGPSIPSASVPPVPP 255 Score = 33.1 bits (72), Expect = 0.055 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = +2 Query: 476 PPXXXPXPPXXXXXXPXPXXXPPPXPP----PXPPXXXPXPXXXPPGPP 610 PP PP P P PPP P PP P PP PP Sbjct: 151 PPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPP 199 Score = 31.5 bits (68), Expect = 0.17 Identities = 25/94 (26%), Positives = 28/94 (29%) Frame = +3 Query: 615 SSXXGXPXXXPPPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPX 794 S+ P PP + PP P P P P P P PPP Sbjct: 119 SASAAPPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAP---PIPSSLPPPA 175 Query: 795 XXXPPXXXPPLSFPXXXGXGGGXXPLLXPPXPPP 896 P PP S P P + P PPP Sbjct: 176 QPAAPVKSPP-SAPSLP----SAVPPMPPKVPPP 204 Score = 31.1 bits (67), Expect = 0.22 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +2 Query: 476 PPXXXPXPPXXXXXXPXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXLXXGXPXPXPP 649 PP PP P P PP PP P PP P L P P PP Sbjct: 144 PPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAP-SLPSAVP-PMPP 199 Score = 29.1 bits (62), Expect = 0.90 Identities = 18/74 (24%), Positives = 19/74 (25%) Frame = +1 Query: 604 APPXPXXXGXXXXXPXPKKNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXPPXP 783 APP P + P P P P PP PP P Sbjct: 123 APPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVK 182 Query: 784 XPPXXXXPPXXXPP 825 PP P PP Sbjct: 183 SPPSAPSLPSAVPP 196 Score = 27.1 bits (57), Expect = 3.6 Identities = 13/45 (28%), Positives = 14/45 (31%) Frame = +3 Query: 477 PXXTXXPPPXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGPP 611 P + PP P P P P PP P P PP Sbjct: 159 PIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPP 203 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 545 PXPPPXPPXXXPXPXXXPPGPP 610 P PPP PP P P P PP Sbjct: 3 PAPPPPPPA--PAPAAAAPAPP 22 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 609 GGPGGXXXGXGXXXGGXGGGXGGGXXXGXGXXXXXWGGXGXXXGG 475 GG G G GG GGG GG G G GG G GG Sbjct: 12 GGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGG 56 Score = 35.5 bits (78), Expect = 0.010 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 609 GGPGGXXXGXGXXXGGXGGGXG---GGXXXGXGXXXXXWGGXGXXXGG 475 GG GG G G GG GG G GG G G GG G GG Sbjct: 16 GGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGG 63 Score = 29.9 bits (64), Expect = 0.51 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -1 Query: 752 GGXGXXGGGXGXXGXXXXGGGXXXXGXXXGFFFGXGXXXXXPXXXGXGGAXXXXXGXXGX 573 G G GG G G GG G G G G G GGA G G Sbjct: 6 GSRGGRGGSRGGRGGF--NGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGG 63 Query: 572 XXGGGGG 552 G GG Sbjct: 64 RGGAKGG 70 Score = 29.9 bits (64), Expect = 0.51 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -3 Query: 648 GGXGXGXPXXRXX-GGPGGXXXGXGXXXGGXGGGXGG 541 G G G R GG GG G G GG GG GG Sbjct: 34 GARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 28.3 bits (60), Expect = 1.6 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 617 GXGGAXXXXXGXXGXXXGGGGGXXXGXXXXXXXXXGGXGGGXGXXXG 477 G G G G GGG G G GG GG G G Sbjct: 20 GFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGG 66 Score = 27.1 bits (57), Expect = 3.6 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -2 Query: 892 GGXGGXRRGXXPPPXPXXXGXXRGGXXXGGXXXXGGGGXGGXXXXXGGXXGXXGXGXGXX 713 GG GG R G RGG G GG G GG GG G G G Sbjct: 9 GGRGGSRGGRG------GFNGGRGGFGGGRGGARGG-GRGGARGGRGGRGGARGGRGGSS 61 Query: 712 G 710 G Sbjct: 62 G 62 Score = 27.1 bits (57), Expect = 3.6 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -1 Query: 791 GGXGXGGXXXXXGGGXGXXGGGXGXXGXXXXGGGXXXXGXXXGFFFGXG 645 G G G GG G GGG G GG G G G G Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRG 58 Score = 26.6 bits (56), Expect = 4.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -1 Query: 821 GXXXGGXXXXGGXGXGGXXXXXGGGXGXXGGGXGXXGXXXXG 696 G GG G G G GG G GG G G G Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 32.3 bits (70), Expect = 0.096 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 527 PXXXPPPXPPPXPPXXXPXPXXXPPGPPXXL 619 P PPP P PP P P P PP L Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAGPPSAPPPPL 1735 Score = 31.5 bits (68), Expect = 0.17 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 646 PXPKKNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXPPXPXP 789 P P P PP P P PP P PP P P P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 31.1 bits (67), Expect = 0.22 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 652 PKKNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXPPXPXPPXXXXPP 810 P P P PP P P PP P PP PP P P PP Sbjct: 1686 PVSTPPVRPQSAAPPQMSA-PTPPPPPMSVPPPP----SAPPMPAGPPSAPPP 1733 Score = 31.1 bits (67), Expect = 0.22 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 694 PPXXXXPXXPXPPPXXPXPPPXXXXXPPXPXPPXXXXPPXXXPP 825 PP P PPP PP PP PP PP Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 31.1 bits (67), Expect = 0.22 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 497 PPXXXXXXPXPXXXPPPXPPPXPPXXXPXPXXXPPGPPXXLXXGXPXP 640 PP P P P PP PP P PP P P P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 29.9 bits (64), Expect = 0.51 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +3 Query: 693 PPXXXXPXXPXP---XPXXPXXPPXXXXXPPXPPPP 791 PP P P P P P PP P PPPP Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 29.1 bits (62), Expect = 0.90 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +1 Query: 463 YTTQTPXXXPXPPPXPPXXXXXXXXXPXXXPPPPPXXXPXXPXXXXXAPPXPXXXGXXXX 642 + TP P P P PPPP P P APP P Sbjct: 1685 HPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPP--SAPPMPAGPPSAPPPPLPASSAPS 1742 Query: 643 XPXP 654 P P Sbjct: 1743 VPNP 1746 Score = 29.1 bits (62), Expect = 0.90 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 693 PPXXXXPXXPXPXPXXPXXPPXXXXXPPXP-PPPXXXXPPXXXPP 824 PP P P P PP PP P PP PP PP Sbjct: 1690 PPVRPQSAAP-PQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 28.7 bits (61), Expect = 1.2 Identities = 15/57 (26%), Positives = 16/57 (28%) Frame = +3 Query: 495 PPPXPXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGPPXSSXXGXPXXXPPPKKKP 665 PP P P P PPP P GPP + P P P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 28.7 bits (61), Expect = 1.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +2 Query: 476 PPXXXPXPPXXXXXXPXPXXXPP-PXPPPXPPXXXPXPXXXPPGPP 610 P P PP P P PP P PP P P P P P Sbjct: 1700 PQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAP-PPPLPASSAPSVP 1744 Score = 28.3 bits (60), Expect = 1.6 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +3 Query: 507 PXXPXPXXPXXPXXXPPPXPXXXXPXPXXXXXGPPXSS---XXGXPXXXPPP 653 P P P P PP P P PP S+ G P PPP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 28.3 bits (60), Expect = 1.6 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 690 PPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPPXXXXPPXXXPPL 827 PP P P PP PP PP P PPL Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPL 1735 Score = 27.9 bits (59), Expect = 2.1 Identities = 18/65 (27%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +3 Query: 633 PXXXPPPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPPPP--XXXXP 806 P PP + + P P P P P P PP P PPPP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTP----PPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Query: 807 PXXXP 821 P Sbjct: 1742 SVPNP 1746 Score = 25.8 bits (54), Expect = 8.4 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 722 PXXPXXTXXPPXXXXXXPXXPXPPXXXPPPXXXPPXXSXXGGXGGGXXPPPXP 880 P P T P P P PPP PP S G PP P Sbjct: 1683 PAHPVSTP-PVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 31.5 bits (68), Expect = 0.17 Identities = 28/110 (25%), Positives = 29/110 (26%), Gaps = 2/110 (1%) Frame = +1 Query: 466 TTQTPXXXPXPPPX--PPXXXXXXXXXPXXXPPPPPXXXPXXPXXXXXAPPXPXXXGXXX 639 T P PPP PP P PPPP P P Sbjct: 157 TVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSG 216 Query: 640 XXPXPKKNPXXXPXXXXPPPXXXXPXXPXPPPXXPXPPPXXXXXPPXPXP 789 P+ P P P P P PPP P PP P P Sbjct: 217 RAVSPEIPPTYTPKQADP-----LPAPPPPPP--PTLPPQSTNTSQLPMP 259 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +2 Query: 476 PPXXXPXPPXXXXXXPXPXXXPPPXPPPXPP 568 PP P P PP PPP PP Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 25.8 bits (54), Expect = 8.4 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 Query: 497 PPXXXXXXPXPXXXPPPXPPPXPP 568 PP P PPP PPP P Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLP 247 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 31.1 bits (67), Expect = 0.22 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 539 PPPXPPPXPPXXXPXPXXXPPGPP 610 PP PPP PP P PP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 30.7 bits (66), Expect = 0.29 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 476 PPXXXPXPPXXXXXXPXPXXXPPPXPPPXPP 568 PP P PP P P PP PPP PP Sbjct: 5 PPGNPPPPP------PPPGFEPPSQPPPPPP 29 Score = 29.1 bits (62), Expect = 0.90 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 771 PPXPPPPXXXXPPXXXPP 824 PP PPPP PP PP Sbjct: 9 PPPPPPPPGFEPPSQPPP 26 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +2 Query: 527 PXXXPPPXPPP--XPPXXXPXPXXXPPG 604 P PPP PPP PP P P PPG Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPP--PPPG 31 Score = 27.5 bits (58), Expect = 2.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 711 PXXPXPXPXXPXXPPXXXXXPPXPPPP 791 P P P P P P PP PPPP Sbjct: 6 PGNPPPPPPPPGFEP--PSQPPPPPPP 30 Score = 27.1 bits (57), Expect = 3.6 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 727 PPPXXPXPPPXXXXXPPXPXPP 792 PP P PPP PP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPP 26 Score = 26.6 bits (56), Expect = 4.8 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +1 Query: 664 PXXXPXXXXPPPXXXXPXXPXPPP 735 P P PPP P P PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXXPXPPPXXPXPPPXXXXXPPXPXPP 792 P P PPP P P PP P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQ--PPPPPPP 30 Score = 26.2 bits (55), Expect = 6.3 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 495 PPPXPXXPXPXXPXXPXXXPPP 560 PPP P P P P PPP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPPP 30 Score = 25.8 bits (54), Expect = 8.4 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = +1 Query: 730 PPXXPXPPPXXXXXPPXPXPPXXXXP 807 PP P PPP P PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 25.8 bits (54), Expect = 8.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 772 PPXPXPPXXXXPPXXXPP 825 PP P PP PP PP Sbjct: 9 PPPPPPPPGFEPPSQPPP 26 Score = 25.8 bits (54), Expect = 8.4 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 771 PPXPPPPXXXXPPXXXPP 824 PP PPPP P PP Sbjct: 10 PPPPPPPGFEPPSQPPPP 27 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 28.3 bits (60), Expect = 1.6 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 10/64 (15%) Frame = +2 Query: 539 PPPXPP-----PXPPXXXPXPXXXPPGPPXXL-----XXGXPXPXPPXQKKTXXXXXXXX 688 PPP PP PP P P GPP G P P P K+T Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPPAGATAISGNPGMPAPVPLTGKETAVPLSSMP 1941 Query: 689 PPPP 700 PP Sbjct: 1942 NAPP 1945 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 28.3 bits (60), Expect = 1.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 691 PPPXXXXPXXPXPP-PXXPXPPPXXXXXPPXPXPPXXXXPPXXXPP 825 PP P P PP P P P PP PP PP P Sbjct: 494 PPTTFAPPGVPLPPIPGAPGMPNLNMSQPPM-VPPGMALPPGMPAP 538 Score = 27.1 bits (57), Expect = 3.6 Identities = 18/68 (26%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +3 Query: 690 PPPXXXXPXXPXPX-PXXPXXPPXXXXXPPXPPPPXXXXPPXXXPPLSFPXXXGXGGGXX 866 PP P P P P P P PP PP P P +P G Sbjct: 494 PPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPAMPGIPG 553 Query: 867 PLLXPPXP 890 P P Sbjct: 554 ATAPPGAP 561 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 27.5 bits (58), Expect = 2.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 892 GGXGGXRRGXXPPPXPXXXGXXRGGXXXGGXXXXGGGGXGG 770 GG GG R G G RGG G GGG GG Sbjct: 138 GGRGGFRGGRGGSRG-GFGGNSRGGFGGGSRGGFGGGSRGG 177 Score = 26.2 bits (55), Expect = 6.3 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = -1 Query: 857 PPPXXXXXKXXGGXXXGGXXXXGGXGXGGXXXXXGGGXGXXGGG--XGXXGXXXXGGGXX 684 P P K G G G G GG GG G GG G G G G Sbjct: 117 PKPKTVGPKKPKGARNG---PAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGG 173 Query: 683 XXGXXXGFFFG 651 G G F G Sbjct: 174 SRGGSRGGFRG 184 Score = 25.8 bits (54), Expect = 8.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -1 Query: 824 GGXXXGGXXXXGGXGXGGXXXXXGGGXGXXGGGXGXXGXXXXGGG 690 GG G GG G GG G GGG GG Sbjct: 141 GGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGG 185 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 23.0 bits (47), Expect(2) = 3.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 542 PPXPPPXPP 568 PP PPP PP Sbjct: 945 PPPPPPPPP 953 Score = 22.2 bits (45), Expect(2) = 3.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 527 PXXXPPPXPPP 559 P PPP PPP Sbjct: 942 PAFPPPPPPPP 952 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 27.1 bits (57), Expect = 3.6 Identities = 15/57 (26%), Positives = 15/57 (26%) Frame = +2 Query: 638 PXPPXQKKTXXXXXXXXPPPPXXXXXXXPXXPXXTXXPPXXXXXXPXXPXPPXXXPP 808 P PP T PPPP P T PP P P P Sbjct: 909 PPPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVPPVQQPSHPNPYTPVAPQSP 965 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 26.2 bits (55), Expect = 6.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 697 PXXXXPXXPXPPPXXPXPPPXXXXXPPXPXPPXXXXPPXXXPP 825 P P P P P P P PP P P P PP Sbjct: 99 PEEPLPREP-PLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPP 140 >SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1334 Score = 25.8 bits (54), Expect = 8.4 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 648 PPKKKPXXXXXXXXPPPXXXXPXXPXPXPXXPXXPPXXXXXPPXPP 785 P +P PPP P P P PP PP PP Sbjct: 37 PAFMEPAPVSKKPLPPPTRRLPRKPLPFRSTSLQPP--SSQPPAPP 80 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,013,679 Number of Sequences: 5004 Number of extensions: 67001 Number of successful extensions: 1071 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 389 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 452494940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -