BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P23 (900 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071724-1|AAL49346.1| 121|Drosophila melanogaster RH40291p pro... 32 1.2 AE014297-3068|AAF55934.1| 121|Drosophila melanogaster CG17820-P... 32 1.2 BT001332-1|AAN71087.1| 886|Drosophila melanogaster AT18855p pro... 29 6.6 AY118833-1|AAM50693.1| 489|Drosophila melanogaster GM01981p pro... 29 6.6 AE014297-980|AAF54409.1| 874|Drosophila melanogaster CG8273-PA ... 29 6.6 >AY071724-1|AAL49346.1| 121|Drosophila melanogaster RH40291p protein. Length = 121 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 83 MNSKLLYFFATVLVCVNAE-VYWEDEEGYPVSGQFSKRHPRDVTWDKQVG 229 MNS L+ + L V A + W +E+ S HP V W VG Sbjct: 1 MNSTLVILLLSALALVQARNIRWSEEDNSSQGPSLSHPHPHSVNWPCDVG 50 >AE014297-3068|AAF55934.1| 121|Drosophila melanogaster CG17820-PA protein. Length = 121 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 83 MNSKLLYFFATVLVCVNAE-VYWEDEEGYPVSGQFSKRHPRDVTWDKQVG 229 MNS L+ + L V A + W +E+ S HP V W VG Sbjct: 1 MNSTLVILLLSALALVQARNIRWSEEDNSSQGPSLSHPHPHSVNWPCDVG 50 >BT001332-1|AAN71087.1| 886|Drosophila melanogaster AT18855p protein. Length = 886 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 297 LCVTGLPKSPSSFWPSVPKTFPPP 226 L T LP P S P+VPK F PP Sbjct: 578 LAATQLPTVPQSVPPTVPKEFAPP 601 >AY118833-1|AAM50693.1| 489|Drosophila melanogaster GM01981p protein. Length = 489 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 297 LCVTGLPKSPSSFWPSVPKTFPPP 226 L T LP P S P+VPK F PP Sbjct: 181 LAATQLPTVPQSVPPTVPKEFAPP 204 >AE014297-980|AAF54409.1| 874|Drosophila melanogaster CG8273-PA protein. Length = 874 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 297 LCVTGLPKSPSSFWPSVPKTFPPP 226 L T LP P S P+VPK F PP Sbjct: 566 LAATQLPTVPQSVPPTVPKEFAPP 589 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,476,614 Number of Sequences: 53049 Number of extensions: 733831 Number of successful extensions: 1362 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1362 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4382549442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -