BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P23 (900 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z30662-1|CAA83137.1| 344|Caenorhabditis elegans Hypothetical pr... 29 3.4 Z74472-5|CAA98943.1| 802|Caenorhabditis elegans Hypothetical pr... 29 6.0 >Z30662-1|CAA83137.1| 344|Caenorhabditis elegans Hypothetical protein T16H12.1 protein. Length = 344 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 270 PSSFWPSVPKTFPPPTCLSQVTSRGCRFEN*PLTGYP 160 P F + PK+ P P C S + C EN P GYP Sbjct: 57 PVHFSQTNPKSTPEPPCTSSSGAGDCH-ENLPADGYP 92 >Z74472-5|CAA98943.1| 802|Caenorhabditis elegans Hypothetical protein F23H12.5 protein. Length = 802 Score = 28.7 bits (61), Expect = 6.0 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = -1 Query: 279 PKSPSSFWPSVPKTF---PPPTCLSQVTSRGCRFEN*PLTGYPSSSSQ*TSALTHTRTVA 109 P+SP +PSVP TF P + TS + T S+++ T A T T T+ Sbjct: 177 PQSPKPTYPSVPSTFEFEKYPKSTEEPTSTPSTSTSTTTTTTTSTTTTTTEAPTTTTTIK 236 Query: 108 KKYNSLE 88 S+E Sbjct: 237 TTTESIE 243 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,660,787 Number of Sequences: 27780 Number of extensions: 360726 Number of successful extensions: 706 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2286823924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -