BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P22 (878 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 26 1.7 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 2.3 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 7.0 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 24 7.0 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.8 bits (54), Expect = 1.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 181 CGLS*ILCPPIAVHDGGSR 125 CG S I PP A+H GGSR Sbjct: 874 CG-SGIASPPAAIHGGGSR 891 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.4 bits (53), Expect = 2.3 Identities = 11/37 (29%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -3 Query: 513 SWSLLFLFVESEERHV--GYFYHLKTNSGNVTDGVTF 409 S+ + F + +++ +V G+F+HL+ N G + TF Sbjct: 901 SYRMYFSQIAADDHYVPSGFFFHLRKNMGGLKRFSTF 937 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 7.0 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 150 MGGQRIQESPHGYEMEG*PFRWC 218 MG I SP G +M F WC Sbjct: 83 MGVMPIMRSPKGVDMPRTTFTWC 105 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.8 bits (49), Expect = 7.0 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 208 FGGASHAKGIVLEKVGVEAKQPNSA--IRKCVRVQLIKNGKKVT 333 FGG + + + + A+ P + RKCVR L K+G ++T Sbjct: 302 FGGFETSTTTLTFALHLLAQHPKAQRKARKCVRSTLAKHGNEMT 345 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 852,713 Number of Sequences: 2352 Number of extensions: 16534 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -