BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P17 (933 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 25 4.3 L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 24 7.6 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 24.6 bits (51), Expect = 4.3 Identities = 21/97 (21%), Positives = 38/97 (39%), Gaps = 2/97 (2%) Frame = -2 Query: 530 GGGSHQRYRXRSXGVQIRSHGVQIRXHGVQIRSHGVQI--RSHAXSYXIQSRGVQIQNRA 357 GG +++RY R+ G + + G Q+ G Q+ S + + A Sbjct: 107 GGSNYRRYMPRATGAPVNNFQYCYSTAGTQMGGPGTQMGGPGTVESQDLFGDMMPQPQPA 166 Query: 356 RSFRIRSHVQSHRTQSHDRNYXIQGCDFQSRQIRNHD 246 R +R+R ++ R + R Q RQ R+ + Sbjct: 167 RPYRVRRAPRAERRHPYTRRSGGQQRSAGWRQSRSDE 203 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 23.8 bits (49), Expect = 7.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 375 PNPESCPKLPNPESRPKSPN 316 P P + PN + RP+SPN Sbjct: 100 PKPMRGRRDPNKQKRPRSPN 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,487 Number of Sequences: 2352 Number of extensions: 7834 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 101708946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -