BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P17 (933 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-905|AAF46171.2| 3166|Drosophila melanogaster CG3950-PA ... 31 3.0 AE014298-594|AAF45916.1| 270|Drosophila melanogaster CG15375-PA... 31 3.0 >AE014298-905|AAF46171.2| 3166|Drosophila melanogaster CG3950-PA protein. Length = 3166 Score = 30.7 bits (66), Expect = 3.0 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 399 LXNPESWCPNPESCPKLPNPESRPKSPNPESR-PKLXNPG 283 L NP P E PK P PKSP + R P + G Sbjct: 1429 LVNPSKKSPKEEDSPKYPKGPETPKSPRNDQRIPSIPKKG 1468 >AE014298-594|AAF45916.1| 270|Drosophila melanogaster CG15375-PA protein. Length = 270 Score = 30.7 bits (66), Expect = 3.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 354 KLPNPESRPKSPNPESRPK 298 K PNP PK PNP RPK Sbjct: 77 KPPNPPEPPKPPNPPERPK 95 Score = 29.5 bits (63), Expect = 6.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 402 KLXNPESWCPNPESCPKLPNPESRPKS 322 ++ N + PNP PK PNP RPK+ Sbjct: 70 QMENEAAKPPNPPEPPKPPNPPERPKA 96 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,862,436 Number of Sequences: 53049 Number of extensions: 406309 Number of successful extensions: 2190 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2161 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4607820675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -