BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P15 (896 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ug... 31 0.17 SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharom... 29 1.2 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 27 3.6 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 27 4.8 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 27 4.8 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 26 6.3 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 26 6.3 >SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ugo1|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 31.5 bits (68), Expect = 0.17 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 277 AIAGPALINPSRTLRPTFSIFLKSFHLGSGAALTAP 170 AIA P +I+P ++RP S+F+KS A + +P Sbjct: 202 AIADPNIISPIDSVRPLLSLFIKSITSAISALILSP 237 >SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 28.7 bits (61), Expect = 1.2 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -2 Query: 214 LKSFH-LGSGAALTAPRASTNAKTKLXIRTKFILPKFYSAGEFKIPIQYRSTRTLRMIKS 38 L+S H L S + T PR N + K + P ++ F+I + Y TR L I++ Sbjct: 291 LQSVHYLISTISATLPRTLYNIVLFMVAAAKTVAPSVFATFAFRISVMYAVTRILPAIQN 350 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/40 (30%), Positives = 13/40 (32%) Frame = +3 Query: 693 PPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P P P P + PP P PPP P P Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 26.6 bits (56), Expect = 4.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 772 AXXGPPPPXPXPPPXTXF 825 A G PPP P PPP F Sbjct: 301 ANGGLPPPPPPPPPSNDF 318 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 26.6 bits (56), Expect = 4.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRP 811 PP P K PP PPP P P Sbjct: 158 PPIPSKAPPIPSSLPPPAQPAAP 180 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 26.2 bits (55), Expect = 6.3 Identities = 11/33 (33%), Positives = 11/33 (33%) Frame = +2 Query: 731 GXXXPPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 G P HP PP R P P P P Sbjct: 1679 GGMAPAHPVSTPPVRPQSAAPPQMSAPTPPPPP 1711 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -3 Query: 819 GXWGRXGXWGGGPXXRXGGF--FXGWGG 742 G +G G GGP GGF F G+GG Sbjct: 188 GGFGGFGGGSGGPPPGPGGFGGFGGFGG 215 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,505,164 Number of Sequences: 5004 Number of extensions: 42572 Number of successful extensions: 163 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 452494940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -