BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P15 (896 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0621 - 4981070-4981136,4982906-4983825 26 0.75 08_01_0059 - 394001-394708 31 0.94 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 31 1.2 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 31 1.2 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.2 11_06_0610 - 25449085-25453284 31 1.6 07_01_0080 + 587674-588510 31 1.6 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 26 1.9 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 30 2.2 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 29 3.8 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 29 3.8 03_01_0515 - 3864796-3865425 29 3.8 02_03_0120 + 15463163-15465250 29 3.8 07_03_1160 - 24430240-24431268 29 5.0 04_03_0904 + 20717005-20718087 29 5.0 02_01_0302 - 2021221-2023305 29 5.0 07_01_0862 - 7172083-7172931 25 6.1 08_02_1084 - 24232968-24234779 29 6.6 02_02_0015 + 6109552-6109650,6110006-6110078,6111937-6111998,611... 29 6.6 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 29 6.6 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 29 6.6 12_02_1174 - 26696869-26698191 28 8.8 12_01_0319 + 2440129-2440661,2440875-2440902 28 8.8 11_06_0208 - 21268722-21268763,21269146-21269274,21269388-212695... 28 8.8 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 28 8.8 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 28 8.8 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 28 8.8 07_03_1381 - 26166673-26166747,26166972-26167544 28 8.8 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 28 8.8 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 28 8.8 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 28 8.8 01_01_1008 - 7987936-7988628,7988923-7989102 28 8.8 08_01_0420 + 3726392-3727116,3727450-3727648,3727787-3727879,372... 24 9.7 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 25.8 bits (54), Expect(2) = 0.75 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 784 PPPPXPXPPP 813 PPPP P PPP Sbjct: 129 PPPPHPLPPP 138 Score = 24.6 bits (51), Expect(2) = 0.75 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 787 PPPXPXPPPXT 819 PPP P PPP T Sbjct: 136 PPPPPTPPPPT 146 >08_01_0059 - 394001-394708 Length = 235 Score = 31.5 bits (68), Expect = 0.94 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP PP R PPP P RP P P Sbjct: 12 PPPATPPPPPRRAPPPPSPPIRPPPPPTP 40 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/49 (34%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXK----TPXXXXXAPPPXPHXAP 812 P PPP R P P + PP + P APPP PH +P Sbjct: 14 PATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPP-PHISP 61 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 694 PPPXXRPXPXXGXSXRXXXXXXXXXXAXXGPPPPXPXPPP 813 PPP P P S GPP P P PPP Sbjct: 309 PPPPPPPPPPMPRSRSASPSPSTSSSGSAGPPAPPPPPPP 348 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 694 PPPXXRPXPXXGXSXRXXXXXXXXXXAXXGPPPPXPXPPP 813 PPP P P + A PPPP P PPP Sbjct: 367 PPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPP 406 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/40 (30%), Positives = 14/40 (35%) Frame = +1 Query: 694 PPPXXRPXPXXGXSXRXXXXXXXXXXAXXGPPPPXPXPPP 813 PPP P P + + PPP P PPP Sbjct: 368 PPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 743 PPHPXKNPPXRXX--GPPPXXPXR---PXQPXXPXGXIGG 847 PP P K PP GPPP P + P P P G GG Sbjct: 337 PPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGG 376 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 728 AGXXXPPHPXKN--PPXRXXGPPPXXPXR-PXQPXXPXG 835 A PP P K PP GPPP P + P P P G Sbjct: 323 AAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKG 361 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP + P P + PP P +PPP P +P Sbjct: 1205 PVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPP-PEKSP 1248 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/45 (28%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP + P P + PP P +PPP P Sbjct: 1173 PVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPP 1217 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/45 (28%), Positives = 16/45 (35%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP + P P + PP P +PPP P Sbjct: 1141 PVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPP 1185 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/45 (28%), Positives = 15/45 (33%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP + P P + PP P PPP P Sbjct: 1157 PVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPP 1201 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/45 (28%), Positives = 15/45 (33%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP + P P + PP P PPP P Sbjct: 1189 PVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPP 1233 >07_01_0080 + 587674-588510 Length = 278 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 719 LXGAGXXXPPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 L G G P P PP PPP P P P P Sbjct: 82 LGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPP 119 >07_03_0111 + 13535912-13535972,13536081-13536142,13536418-13536510, 13537577-13537649,13537876-13538265,13538337-13538404, 13539334-13539375,13540211-13540735,13540817-13540974, 13541078-13541636,13542438-13542500,13542579-13542680, 13542779-13543096,13543175-13543267,13543489-13543590, 13543678-13543782,13544190-13544323,13545097-13545280, 13545701-13545832,13546215-13546327,13546468-13546558, 13547138-13549339 Length = 1889 Score = 26.2 bits (55), Expect(2) = 1.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 772 AXXGPPPPXPXPP 810 A GPPPP P PP Sbjct: 119 ASFGPPPPPPPPP 131 Score = 22.6 bits (46), Expect(2) = 1.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 784 PPPPXPXPPP 813 PPPP P P P Sbjct: 124 PPPPPPPPSP 133 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 725 GAGXXXPPHPXKNPPXRXXGPPPXXPXRP--XQPXXPXGXIGG 847 G+G P P + PP PPP P P P P +GG Sbjct: 260 GSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGG 302 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXA 809 P PPP P P PP P PPP P A Sbjct: 270 PQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLA 313 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 1158 PPLPPSPPPATPPPPPPLSPSLPPPPPPP 1186 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 767 GGFXXGGGGRXDXPXKGXGRXXGGG 693 GG+ GGGG +G GR GGG Sbjct: 117 GGYGRGGGGYHGDGERGYGRGGGGG 141 >03_01_0515 - 3864796-3865425 Length = 209 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +3 Query: 693 PPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 PPP P P PP P +PPP P +P Sbjct: 85 PPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P +PP PPP P + P P Sbjct: 92 PPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 >02_03_0120 + 15463163-15465250 Length = 695 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = +3 Query: 693 PPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPH 803 PPP + P PP +P +PPP PH Sbjct: 284 PPPTKYIGPMPPNNQPLPPPPSPSPSPPPPSPPPPPH 320 >07_03_1160 - 24430240-24431268 Length = 342 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P N P + PP P P +P P Sbjct: 229 PPQPIPNGPIKPDQPPQPNPDMPPKPDQP 257 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPP---PXXPXRPXQPXXP 829 PP P N P + PP P P +P QP P Sbjct: 271 PPQPNPNGPPKPDQPPQPNPNGPSKPDQPPRP 302 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPP---PXXPXRPXQPXXP 829 PP P N P + PP P P +P QP P Sbjct: 285 PPQPNPNGPSKPDQPPRPNPDMPPKPDQPPQP 316 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPP 794 P P P P P+ PPT TP PPP Sbjct: 312 PTPYKPQPKPTPSPYTPKPTPTPPTYTPTPTPPYHKPPP 350 >02_01_0302 - 2021221-2023305 Length = 694 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 725 GAGXXXPPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 G G PP P +PP R GP P P P P Sbjct: 394 GRGGQGPPAPVSSPP-RRRGPYPQPPSSSPTPSYP 427 >07_01_0862 - 7172083-7172931 Length = 282 Score = 24.6 bits (51), Expect(2) = 6.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 787 PPPXPXPPPXT 819 PPP P PPP T Sbjct: 127 PPPPPPPPPPT 137 Score = 22.6 bits (46), Expect(2) = 6.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 784 PPPPXPXPPP 813 P PP P PPP Sbjct: 125 PAPPPPPPPP 134 >08_02_1084 - 24232968-24234779 Length = 603 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P K PP + PPP P Q P Sbjct: 66 PPLPQKQPPSQQLPPPPQQQQPPPQHSLP 94 >02_02_0015 + 6109552-6109650,6110006-6110078,6111937-6111998, 6112315-6112376,6112463-6112556,6112673-6113227, 6113379-6113870,6113967-6114137,6115713-6115817, 6115903-6116052,6116372-6116498,6116585-6116648, 6117147-6117203,6117423-6117555,6117660-6117746 Length = 776 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXPXG 835 PP P +PP P P P RP P P G Sbjct: 275 PPRPI-DPPRPIDPPRPIDPPRPIDPPRPNG 304 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRP 811 PPHP ++PP PP P P Sbjct: 124 PPHPPEDPPPHPPHPPDHPPPPP 146 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/46 (30%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGX-VXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P PF + PP+ P + PP P+ P Sbjct: 964 PPPPPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVPPPPNSPP 1009 >12_02_1174 - 26696869-26698191 Length = 440 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +1 Query: 694 PPPXXRPXPXXGXSXRXXXXXXXXXXAXXGPPPPXPXPPP 813 PPP R R + PPPP P PPP Sbjct: 125 PPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPP 164 >12_01_0319 + 2440129-2440661,2440875-2440902 Length = 186 Score = 28.3 bits (60), Expect = 8.8 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 781 GPPPPXPXPPP 813 GPPPP P PPP Sbjct: 45 GPPPPPPPPPP 55 >11_06_0208 - 21268722-21268763,21269146-21269274,21269388-21269537, 21270402-21270773 Length = 230 Score = 28.3 bits (60), Expect = 8.8 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 781 GPPPPXPXPPP 813 GPPPP P PPP Sbjct: 17 GPPPPPPPPPP 27 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 694 PPPXXRPXPXXGXSXRXXXXXXXXXXAXXGPPPPXPXPPP 813 PPP P P A PPPP P PP Sbjct: 27 PPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGPP 66 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 725 GAGXXXPPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 G G PP P + P PP P P P P Sbjct: 238 GQGFNSPPPPGQGPVLPRDAPPMPPPPSPPNPGAP 272 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 725 GAGXXXPPHPXKNPPXRXXGPPPXXPXRPXQP 820 G PP P PP PP P P QP Sbjct: 100 GVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQP 131 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 28.3 bits (60), Expect = 8.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 772 AXXGPPPPXPXPPPXT 819 A PPPP P PPP T Sbjct: 157 ANENPPPPPPPPPPTT 172 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 743 PPHPXKNPPXRXXG-PPPXXPXRPXQPXXP 829 PP P PP R PPP P P P P Sbjct: 74 PPPPAPRPPRRHHRIPPPPPPLLPTPPPPP 103 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 28.3 bits (60), Expect = 8.8 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 781 GPPPPXPXPPP 813 GPPPP P PPP Sbjct: 548 GPPPPPPPPPP 558 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 28.3 bits (60), Expect = 8.8 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 781 GPPPPXPXPPP 813 GPPPP P PPP Sbjct: 421 GPPPPPPPPPP 431 >01_01_1008 - 7987936-7988628,7988923-7989102 Length = 290 Score = 28.3 bits (60), Expect = 8.8 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 781 GPPPPXPXPPP 813 GPPPP P PPP Sbjct: 152 GPPPPSPSPPP 162 >08_01_0420 + 3726392-3727116,3727450-3727648,3727787-3727879, 3728001-3728129,3728445-3728498,3728597-3728674, 3728773-3728835,3729101-3729213,3729392-3729500 Length = 520 Score = 23.8 bits (49), Expect(2) = 9.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 772 AXXGPPPPXPXPP 810 A PPPP P PP Sbjct: 93 AALAPPPPPPPPP 105 Score = 22.6 bits (46), Expect(2) = 9.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 784 PPPPXPXPPP 813 PPPP P P P Sbjct: 100 PPPPPPTPSP 109 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,960,579 Number of Sequences: 37544 Number of extensions: 376490 Number of successful extensions: 4130 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3331 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -