BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P15 (896 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 36 0.059 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 36 0.059 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 33 0.41 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 31 1.7 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 30 2.2 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 30 2.2 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 30 2.2 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 29 3.9 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 29 5.1 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 29 5.1 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_13204| Best HMM Match : GRP (HMM E-Value=0.0017) 28 8.9 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) 28 8.9 SB_41763| Best HMM Match : S_layer_C (HMM E-Value=1.2) 28 8.9 SB_41761| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.025) 28 8.9 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 28 8.9 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 28 8.9 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +3 Query: 693 PPPXRX-----PXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 PPP R P P G + PP K P APPP P AP Sbjct: 321 PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP 365 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 693 PPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXP 800 PPP R P P G PP + P PPP P Sbjct: 359 PPPGRAPQPLGGP--PPPPPGRRPPSGKINPPPPPP 392 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = +2 Query: 731 GXXXPPHPXKNPPXRXXGPPPXXPXRPXQPXXPXGXI 841 G PP P + PP PPP P +P G + Sbjct: 369 GGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGPV 405 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXPXG 835 PP P + P R PPP RP P P G Sbjct: 217 PPPPGRGPSQRSLAPPPTGSSRPL-PAPPPG 246 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQP 820 PP P PP PP P R QP Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAPQP 367 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +3 Query: 693 PPPXRX-----PXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 PPP R P P G + PP K P APPP P AP Sbjct: 233 PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP 277 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 693 PPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXP 800 PPP R P P G PP + P PPP P Sbjct: 271 PPPGRAPQPLGG--PPPPPPGRRPPSGKINPPPPPP 304 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = +2 Query: 731 GXXXPPHPXKNPPXRXXGPPPXXPXRPXQPXXPXGXI 841 G PP P + PP PPP P +P G + Sbjct: 281 GGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGPV 317 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXPXG 835 PP P + P R PPP RP P P G Sbjct: 129 PPPPGRGPSQRSLAPPPTGSSRPL-PAPPPG 158 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQP 820 PP P PP PP P R QP Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAPQP 279 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 725 GAGXXXPPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 G G PP P PP PPP P P P P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 31.5 bits (68), Expect = 0.96 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP+P PP PPP P P P P Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP+P PP PPP P P P P Sbjct: 111 PPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 693 PPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 PPP P P PP P PPP P P Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP+ PP PPP P +P +P P Sbjct: 792 PPNIPSRPPGARPTPPPPPPGKPTKPTKP 820 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -1 Query: 188 SSADRAESQHQREDEAQXTYEIHFTEIL*CRRIQNSN 78 + D E + + E+E + +YE +TEIL RR+ + N Sbjct: 341 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRVVSFN 377 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -1 Query: 188 SSADRAESQHQREDEAQXTYEIHFTEIL*CRRIQNSN 78 + D E + + E+E + +YE +TEIL RR+ + N Sbjct: 985 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRVVSFN 1021 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P +PP PPP P P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP P PPP P AP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P +PP PPP P P P P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP P APPP P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP + PPP P P P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 728 AGXXXPPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 AG P P PP PPP P P P P Sbjct: 359 AGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPP 392 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQP 395 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P + PP PPP P P P P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP + P P PP P PPP P P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPP 393 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP + P PPP P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP P PPP P P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P P P P Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP P PPP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP P PPP P P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 693 PPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 PPP P P PP P PPP P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP P PPP P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP P PPP P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP P PPP P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXPHXAP 812 P PPP P P PP P PPP P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P + PP PPP P P P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P +PP R PPP P RP P Sbjct: 219 PPPPSPSPP-RPPPPPPPSPPRPLAAKLP 246 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQPXXP 829 PP P PP PPP P +P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 5/45 (11%) Frame = +1 Query: 694 PPPXXRPXPXXGXSXRXXXXXXXXXXAXX-----GPPPPXPXPPP 813 PPP P P G A GPPPP P PPP Sbjct: 685 PPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPP 729 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXP 800 P PP P P G PP + P PPP P Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 731 GXXXPPHPXKN--PPXRXXGPPPXXPXRPXQPXXPXGXIG 844 G PP P + PP G PP P R P P +G Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMG 323 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 773 AXGGFXXGGGGRXDXPXKGXGRXXGGG 693 A GGF GGGG D G G GG Sbjct: 352 AVGGFGGGGGGSEDNGASGGGGGYSGG 378 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 773 AXGGFXXGGGGRXDXPXKGXGRXXGGG 693 A GGF GGGG D G G GG Sbjct: 222 AVGGFGGGGGGSEDNGASGGGGGYSGG 248 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 678 PXXXXPPPXRXPXPFXGXVXXXPPTXXKTPXXXXXAPPPXP 800 P PP P P G PP P PPP P Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 >SB_13204| Best HMM Match : GRP (HMM E-Value=0.0017) Length = 723 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 828 GKXGXWGRXGXWGGGPXXRXGGFFXGWG 745 G G WG WGG G F GWG Sbjct: 477 GFPGGWGHGLGWGGPGFGWGGPGFGGWG 504 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 743 PPHPXKNPPXRXXGPPPXXPXRPXQP 820 PP P PP PPP P P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) Length = 1953 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 235 RPTFSIFLKSFHLGSGAALTAPRASTN 155 RP+F + LKS G+GAA P TN Sbjct: 1831 RPSFKLVLKSLEEGNGAARVRPCRITN 1857 >SB_41763| Best HMM Match : S_layer_C (HMM E-Value=1.2) Length = 393 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 373 IHNYLQYCFKLNASLVXYHEVYFPKDFACPMT 278 +HN +YC LN ++ H ++PK P+T Sbjct: 156 VHN-TKYCIPLNHPILSEHGAFYPKALPHPLT 186 >SB_41761| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.025) Length = 1480 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 373 IHNYLQYCFKLNASLVXYHEVYFPKDFACPMT 278 +HN +YC LN ++ H ++PK P+T Sbjct: 1323 VHN-TKYCIPLNHPILSEHGAFYPKALPHPLT 1353 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 781 GPPPPXPXPPP 813 GPPPP P PPP Sbjct: 358 GPPPPPPPPPP 368 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 28.3 bits (60), Expect = 8.9 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 Query: 781 GPPPPXPXPPP 813 GPPPP P PPP Sbjct: 194 GPPPPPPPPPP 204 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,983,443 Number of Sequences: 59808 Number of extensions: 328117 Number of successful extensions: 2040 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1580 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2574115416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -