BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P13 (858 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pomb... 28 2.0 SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosa... 27 3.4 SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces po... 27 3.4 SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|... 27 4.5 SPAC8C9.09c |mug129||sequence orphan|Schizosaccharomyces pombe|c... 26 6.0 >SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 1018 Score = 27.9 bits (59), Expect = 2.0 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 624 SNVRDVDVXLGDQPRT-PNEIPESXTXDHATXSTSETMRSP 743 SN+RD++ + D+PR+ P+ IP S + H+ E P Sbjct: 662 SNIRDMEHTISDKPRSEPDAIPSSKSM-HSNKPFEEKSEKP 701 >SPCC584.04 |sup35|erf3|translation release factor eRF3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 662 Score = 27.1 bits (57), Expect = 3.4 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 126 PRHSTTMARHIGRITITT-PSVLTFGKACWTHI 221 P H+TT R I +I I PS+LT G +C HI Sbjct: 553 PVHATT--RFIAQIAILELPSILTTGYSCVMHI 583 >SPAC32A11.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 851 Score = 27.1 bits (57), Expect = 3.4 Identities = 16/65 (24%), Positives = 31/65 (47%) Frame = +2 Query: 200 ESMLDTHSLWSNLANEMQHLDNMMKELSLKFPSIINEGRVEGDKYQISIHLPGYEQKDIN 379 E + + +W+++ +MQ D ++L F I N G++ Q +I L G + ++ Sbjct: 104 EGSTNVNEVWNDITEDMQSQDFSTEDLKQLFLLIFNNGKLR-TLLQNAIVLLGQQTTNVA 162 Query: 380 VKAKN 394 K N Sbjct: 163 SKKLN 167 >SPAC6G9.10c |sen1||ATP-dependent 5' to 3' DNA/RNA helicase Sen1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 26.6 bits (56), Expect = 4.5 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = +2 Query: 164 YHHYDPFSPYVRESMLDTHSLWSNLANEMQHLDNMMKELSLKFPSIINEGRV 319 + Y F +E +T S + NL E+++L NM+ EL KFP + GR+ Sbjct: 1484 FTQYRLFDVRGKERTSNTMSTY-NL-EEVEYLVNMVDELLNKFPDVNFTGRI 1533 >SPAC8C9.09c |mug129||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 302 Score = 26.2 bits (55), Expect = 6.0 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 564 QPTDTTSTNVSREEMEFXTQSNVRDVDVXLGDQPRTPNEIPE 689 QP D+ + R+ E T S+ DVD+ LG E P+ Sbjct: 203 QPVDSVANPQLRKASEITTISSRSDVDILLGKFKALIQESPD 244 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,207,269 Number of Sequences: 5004 Number of extensions: 61846 Number of successful extensions: 164 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -