BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P12 (841 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 28 0.41 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 25 3.8 AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 24 5.0 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 8.7 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 27.9 bits (59), Expect = 0.41 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +2 Query: 278 EFKEAFQLMDHDKDGIIGKNDLRATFDSLGRLASEKELDEMVGEASGP 421 +F E +L D ++DG + +L + +LG + ELD ++ + P Sbjct: 86 DFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKDCMDP 133 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 24.6 bits (51), Expect = 3.8 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 235 RIQCLLYVLTEAGRRVQGGIPANGSRQGWHHRQERLARHLRLPGQ 369 R Q LL + R+ Q + RQ W +Q++ R RLP Q Sbjct: 166 REQELLRRMESQQRQEQRQQLEDQQRQRWRQQQQKQQRQQRLPAQ 210 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 24.2 bits (50), Expect = 5.0 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 244 CLLYVLTEAGRRVQGGIPANG 306 C++ +T ++ QGG+PA G Sbjct: 36 CVVQAITNTFQKFQGGVPALG 56 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 8.7 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 505 SRPSMKRERSILXGSGTPS*PWGXQFSADEVXXAYDQMD 621 ++ SMK I GSGTP W + DE D +D Sbjct: 1791 NKHSMKGSNPIWIGSGTPEGEW----AKDEFDKCKDAID 1825 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 559,811 Number of Sequences: 2352 Number of extensions: 8065 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -