BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P11 (1031 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 1.7 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 5.1 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 6.7 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect(2) = 1.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 541 PPPPPPXKXXF 573 PPPPPP F Sbjct: 732 PPPPPPRVESF 742 Score = 20.6 bits (41), Expect(2) = 1.7 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 535 PXPPPPP 555 P PPPPP Sbjct: 731 PPPPPPP 737 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.6 bits (46), Expect = 5.1 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 308 GGEIFPXPRGEXNPPXXPPPPNKXPXGXKKKPP 406 GG++F P +P P P + P PP Sbjct: 402 GGQMFEAPIPNVSPHYVTPTPPEAPLFQNVLPP 434 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 6.7 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +1 Query: 472 PPPGXKPXXWXXXXXPPLXFXPXPPPPP 555 P P P + PPL P P PP Sbjct: 160 PGPALPPTGFLCNNYPPLPQVPPLPLPP 187 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,769 Number of Sequences: 336 Number of extensions: 3717 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 58 effective length of database: 103,097 effective search space used: 29382645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -