BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P10 (856 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 26 1.3 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 9.0 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 26.2 bits (55), Expect = 1.3 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 302 CCNQLFQRVHHRFVPKCQRPCLPPFVCPK 216 CC Q+ KCQ CLP VC K Sbjct: 34 CCAPCPQKACISEAVKCQTSCLPGCVCKK 62 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.4 bits (48), Expect = 9.0 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -2 Query: 576 RPTSGLL*PNSFETIPPAEKWVFXSRSHTPEPDAVIPDLPPICL 445 +P+ + P+S T PPA + PEP A + +P + L Sbjct: 87 QPSLAPVVPSSVVTAPPARPSQPPTTRFAPEPRAEVKFVPSVPL 130 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 833,666 Number of Sequences: 2352 Number of extensions: 18731 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -